Cameronol » deal and competition votes

1870

expired 6 Free Reading Eggs eBooks @ Amazon AU

The main link has all the Readings Eggs content. Links below are direct links to the free ebooks. You can download your free e-books straight onto your Kindle device, Kindle for PC, Kindle for …

1880
[Android, iOS] Free: "RIDBC Auslan Tutor" $0 @ Google Play & Apple App Store

expired [Android, iOS] Free: "RIDBC Auslan Tutor" $0 @ Google Play & Apple App Store

The RIDBC Auslan Tutor is a video-based Australian Sign Language teaching app. The RIDBC Auslan Tutor has been designed to assist families of young deaf children learn Auslan. More than 500 …

2170

expired Microsoft Ignite - Earn Free Exam Voucher Worth US$165

You need to complete 1 x challenge to get an exam voucher, though it is worth it considering that exam vouchers are usually US$165. This voucher is valid for a lot of exams, only close thing to this …

280
Free Short Course: Detecting and Defending Against Cyber Threats @ IT Masters

expired Free Short Course: Detecting and Defending Against Cyber Threats @ IT Masters

We’ve all seen this year how cyber attacks are increasing in frequency, while threat actors are evolving in their attack strategies. In our next free short course we will give you practical tools …

1050
Free Downloadable Digital Care Packs for Kids @ Smiling Mind

expired Free Downloadable Digital Care Packs for Kids @ Smiling Mind

This is a Victorian Government initiative to help support the mental health of kids aged 5-12 during COVID. The packs are created by psychologists and include worksheets and activities to promote …

520
[VIC] Free Delivery on Orders > $15 @ Subway via UberEATS

expired [VIC] Free Delivery on Orders > $15 @ Subway via UberEATS

SUBWAYTOYOU

Same as previous deal. $15 min spend, free delivery. Enjoy. Locations: Melbourne, Geelong, Bendigo and Ballarat.

2760
Free: Microsoft Azure Fundamentals AZ-900 Virtual Training + Free Voucher for Certification Exam @ Microsoft

out of stock Free: Microsoft Azure Fundamentals AZ-900 Virtual Training + Free Voucher for Certification Exam @ Microsoft

Stay safe, and enjoy :) To create your vision for tomorrow, you need to understand what the cloud can do for you and your company today. Microsoft Azure Virtual Training Day: Fundamentals …

7530
Residential Gigabit nbn Plans on FTTP and HFC 1000/50Mbps $149/mth, 250/100Mbps $209/mth, 250/25Mbps $129/mth @ Aussie Broadband

expired Residential Gigabit nbn Plans on FTTP and HFC 1000/50Mbps $149/mth, 250/100Mbps $209/mth, 250/25Mbps $129/mth @ Aussie Broadband

Live now! Website is slow right now but live chat and the sales phone number are processing orders. 1000/50 - $149 a month 250/25 - $129 a month Check what speed tier your HFC can get Source …

1140

expired [eBook] Free: "4-in-1 Info Tech eBook Bundle" (Python for Beginners, Python 3 Guide, Learn Java, Excel 2016) $0 @ Amazon

This eBox Includes 4 Manuscripts in 1 book: Python For Beginners: A Crash Course Guide To Learn Python in 1 Week Python 3 Guide: A Beginner Crash Course Guide to Learn Python 3 in 1 …

650
Audio Technica AT9920 Microphone $39.99 + $9.95 Shipping @ Ted's Cameras

out of stock Audio Technica AT9920 Microphone $39.99 + $9.95 Shipping @ Ted's Cameras

A great portable and/or desktop microphone for those who missed out on Audio Technica's recent giveaway. This has a RRP of $119 but seems to be on a great special at Ted's. There are more …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

2020

expired [eBook] Free: "InQUIZitive - The Best Trivia and Pub Quiz Game Books" $0 @ Amazon

Author: In the InQUIZitive series, I have tried to make sure that the readers have many "Aha!" moments. Additionally, I have taken great efforts to present the details in such a way to …

4090
Free - 5 Years Subscription to 240+ Microsoft Azure Courses, Exams & Articles @ Pluralsight

expired Free - 5 Years Subscription to 240+ Microsoft Azure Courses, Exams & Articles @ Pluralsight

I set up a new trial for 10 days and was able to subscribe to Azure to 29/4/2025. Follow the link to sign-up using your existing or new account and the subscription will be activated. Almost …

34
Win an Elgato Stream Deck from PC Case Gear

closed Win an Elgato Stream Deck from PC Case Gear

  • Australia-wide
  • Gleam, Website
880
[WA] Free RAC Roadside Assistance for First Responders & Health Care Workers

expired [WA] Free RAC Roadside Assistance for First Responders & Health Care Workers

RAC is offering every West Australian frontline healthcare professional and first responder free breakdown service during COVID-19. Whether you're a member or not. If you're a roadside …

1530

expired Free Course - Practical Ethical Hacking - The Complete Course @ Udemy

STAYINSIDEANDLEARN2

2020 Launch! Learn how to hack like a pro by a pro. Up to date practical hacking techniques with absolutely no filler. HIGHEST RATED 4.7 (4,062 ratings) 26,590 students enrolled What you'll …

1983
Free Delivery at Guzman Y Gomez via Uber Eats

expired Free Delivery at Guzman Y Gomez via Uber Eats

GYGFREEDELIVERY

As you would expect, GYG and its franchisees are suffering badly from the COVID-19 impact (just as much as other food and restaurant businesses) and have not been immune from the need to shut stores …

15685
Free AT99 Microphones @ Audio Technica Australia

expired Free AT99 Microphones @ Audio Technica Australia

Edit: site down due to being ozbargained Good gesture from Audio Technica. Whether you’re working from home, creating content or just need to make an important call, Audio-Technica is here to …

2620
Duracell Procell Industrial AA or AAA Box of 24 - $9.24 (+ $8.94 Shipping Per Order) @ HB Plus Battery Specialists

out of stock Duracell Procell Industrial AA or AAA Box of 24 - $9.24 (+ $8.94 Shipping Per Order) @ HB Plus Battery Specialists

An Apology to OzBargainer's Hi All, Here is a short video apology to all of the users effected and a thank you to those OzBargainers that supported me: https://vimeo.com/399035194 As promised …

3141
$0 Activation & $0 Fee for All Pick-up Orders for Restaurants @ Uber Eats

expired $0 Activation & $0 Fee for All Pick-up Orders for Restaurants @ Uber Eats

Outstanding initiative by Uber Eats to ease the strain on restaurants and small business and for also giving away 25,000 meals for our healthcare workers on the frontline. To show our support for …

1070
Free ServiceNow Training and Certification

expired Free ServiceNow Training and Certification

*edited url with suggestion from comments to help people registering Hi guys, My turn to finally contribute. ServiceNow are currently offering free training and certification in their platform via …

2010
Free Delivery on Next 2 Orders @ UberEATS

expired Free Delivery on Next 2 Orders @ UberEATS

eats501

[TARGETED] You've scored a promo for 2 FREE deliveries. Enter the promo code below in the 'Promotions' section of the Uber Eats app, and your delivery fee will be covered on up to 2 …

3010
3 Free Deliveries @ Uber Eats

expired 3 Free Deliveries @ Uber Eats

eats275

I received an email for the offer of 3 free deliveries.Possibly Targeted Enter the promo code below in the "Promotions" section of the Uber Eats app, and your delivery fee will be covered …

3784
[PC/Mac] 1 Year Free CCleaner Professional License (Normally $24.95) @ Piriform

expired [PC/Mac] 1 Year Free CCleaner Professional License (Normally $24.95) @ Piriform

P9WV-AFZU-4EW8-HAM9-QWHF

Greetings everyone, Piriform are offering a 1-year free license for the Pro version of their CCleaner app :) Steps: Download and install the free version of the program from the official …

1210
2.6kg CO2 Gas Cylinder Filled with Gas for $66.95 (6kg for $83) - Use with Sodastream etc @ Kegland

expired 2.6kg CO2 Gas Cylinder Filled with Gas for $66.95 (6kg for $83) - Use with Sodastream etc @ Kegland

Similar to deals in the past, kegland have the 2.6kg CO2 cylinder for $66.95. They also have stock of the 36 inch adapter for Sodastream …

1100
[BF] 10% off for All Volunteer Firefighters and Emergency Services Personnel @ Woolworths, BIG W, BWS & Dan Murphy's

expired [BF] 10% off for All Volunteer Firefighters and Emergency Services Personnel @ Woolworths, BIG W, BWS & Dan Murphy's

Hi all. In our team meeting today, we were informed that all emergency services will get 10% off their groceries at all Woolworths in WA at all Woolworths Group retail stores nationwide. Could be …

9140
Free Google Nest Mini for YouTube Premium / Google Play Music Subscribers (AUD Subscribers)

expired Free Google Nest Mini for YouTube Premium / Google Play Music Subscribers (AUD Subscribers)

Opened up the YouTube app and was greeted with this offer. Available for YouTube premium and Google Play Music subscribers. Try your luck with this old link. Several users have reported success. …

470
40% off Sale Items at Checkout: Boots $89.40 (RRP $249), Pure Wool Jacket $41.97 (RRP $349) & More @ Country Road Outlet

expired 40% off Sale Items at Checkout: Boots $89.40 (RRP $249), Pure Wool Jacket $41.97 (RRP $349) & More @ Country Road Outlet

Extra 40% off (discount) nearly on all sale items while stocks last Discount applied at check out. Find a bug: if the price is over $100 (pre-discount), when add it at checkout, it will be shipped …

3080
Shodan.io Lifetime Membership for USD$1 (~AUD$1.50)

expired Shodan.io Lifetime Membership for USD$1 (~AUD$1.50)

Normal $49 US, down to $1 US. What it is, from Wikipedia: Shodan is a search engine that lets the user find specific types of computers (webcams, routers, servers, etc.) connected to the …

2030

expired $0 Udemy Courses: Windows Server 2019, Server 2012 R2 Hands-on, Learn C#, Microsoft Excel, Complete Android & More @ Udemy

Found some free codes on good courses. Enjoy :) Microsoft Windows Server 2019 - Hands-on Training Part I Server 2012 R2 - Hands-on Training Part I Server 2012 R2 - Hands-on Training Part II Learn …

2920
Free Windows 10 Education for Students (Even after You Graduate) @ OnTheHub

expired Free Windows 10 Education for Students (Even after You Graduate) @ OnTheHub

Previous deal is well over 12 months old, and I think we are overdue for a reminder. Furthermore, a few things have changed since 2017, so this may not even be classified as a dupe in the first …

1500

expired [Amazon Prime] Logitech MX Master 2S Wireless Mouse Graphite $82.65 Delivered @ Amazon AU

Great price on this mouse $73.64 after Cashback - looks like they're waiting on more stock as it's down as 1-2 months but in my experience it would more than likely ship soon Todays 12% …

1740
FREE Student Developer Pack (Free .me Domain, Azure, Web Hosting, Training, Analytics, + More) @ GitHub

expired FREE Student Developer Pack (Free .me Domain, Azure, Web Hosting, Training, Analytics, + More) @ GitHub

It's been a long time since this deal was posted so now it's back with a few changes. Perfect for any students out there studying Computer Science or related courses. Eligibility …

4840

Long Running Free - Microsoft Hyperlapse Pro (Was US $50) @ Microsoft

6NQYH-7DV6T-GY9BH-HTHPC-YKPCM

A good software to use with videos from your GoPro. Available for PC and Mac. Download the software and apply the key - 6NQYH-7DV6T-GY9BH-HTHPC-YKPCM. Microsoft Hyperlapse is a new technology …

730
Meguiars Car Wash Snow Cannon Kit SNOWKIT $51.96 Shipped @ SparesBox eBay

expired Meguiars Car Wash Snow Cannon Kit SNOWKIT $51.96 Shipped @ SparesBox eBay

PASSENGER

Meguiars Car Wash Snow Cannon Kit SNOWKIT Cheapest I have seen so far. Normally seen lowest around $75.

543
Samsung 860 EVO 1TB 2.5" SSD $219 ($174 after $45 Cashback) @ Centre Com

expired Samsung 860 EVO 1TB 2.5" SSD $219 ($174 after $45 Cashback) @ Centre Com

Price is $219 however they're doing cashback for $45 which makes it $174 delivered! Up to $300 Cashback on Samsung SSD's (E.G 860 Evo 1TB $45 Cashback) @ Samsung

2180

out of stock Wahl WA9243-4912 Home Pro Hair Clipper $14.90 (Was $59.95) Shipped @ Shaver Shop

SHAVE10

Product Description Self-Sharping High-Carbon Steel Blades PowerDrive Technology Corded Clipper Guide Combs: Clipper Blade Guard No. 1 - 1/8" (3mm) No. 2 - 1/4" (6mm) No. 3 - 3/8" …

1080
20%/25%/30% off $100-$149.99/ $150-$199.99/ $200 or More Spend @ SuperCheap Auto Online Only

expired 20%/25%/30% off $100-$149.99/ $150-$199.99/ $200 or More Spend @ SuperCheap Auto Online Only

SAVE20SAVE25SAVE30

Spend $100-149.99 get 20% off Spend $150-199.99 get 25% off Spend $200 or more get 30% off One coupon per transaction Excludes giftcard, tyres, services, shipping & handling Excludes sale items, …

1320

out of stock Terminal or Chelsea (Leather) Boots $49.95 (Was $159.95-$179.95) Shipped @ Hush Puppies

HELLOVIP

BECOME A HUSH PUPPIES VIP MEMBER-SIGN UP AND SAVE $10 via code. Free shipping if spend over $99 (still can have $10 off via the code if you are a new customer) Use Paypal for free return: original …

3850
Get $15 off $100 Spend, Get $20 off $150 Spend @ eBay (Check Your eBay Summary Page - Most Are Receiving One of the Offers)

expired Get $15 off $100 Spend, Get $20 off $150 Spend @ eBay (Check Your eBay Summary Page - Most Are Receiving One of the Offers)

TAKE15TAKE20

Check/refresh your eBay summary page to see if & which offer you received. T&Cs here and here. Good luck :) $15/$20 off the purchase price on all eligible items listed on www.ebay.com.au …

3660
20% off Storewide @ Computer Alliance eBay

expired 20% off Storewide @ Computer Alliance eBay

PCSAVE

T&Cs here. Max discount $1000 per transaction (3 max). $15 flat rate postage (not per item) or free shipping with eBay Plus membership. Enjoy :) Click the related button above to see all PCSAVE …

1494
Supercheap Auto 20% - 60% Storewide. Saturday 21st Only

expired Supercheap Auto 20% - 60% Storewide. Saturday 21st Only

Hey guys Just got this email through. Looks like there could be some decent stuff up for grabs $5 shipping for Club Plus members for orders over $99

6720
[VIC] Get $50 Cheque When You Use The Victorian Energy Compare Website to Compare Provider Offers (1 Per Household)

expired [VIC] Get $50 Cheque When You Use The Victorian Energy Compare Website to Compare Provider Offers (1 Per Household)

The Victorian Government has announced today that from July 1 to December 31 this year June 30 2019, if you use the Victorian Energy Compare website to see if there are better energy deals available …

1140
2.6kg CO2 Gas Cylinder Filled with Gas for $69 ($20 Discount in Cart) - Use with Sodastream etc @ Kegland

expired 2.6kg CO2 Gas Cylinder Filled with Gas for $69 ($20 Discount in Cart) - Use with Sodastream etc @ Kegland

Here's a deal for the more inventive among you. 2.6KG Gas Cylinder filled with carbon dioxide. Just what the hell would you do with a cylinder full of CO2 you ask? Well, there are many uses. …

1120

expired FREE - Remaking the Legend – Halo 2: Anniversary [Documentary] @ Microsoft Store

Just watched it, thought it was heaps good and worth the watch. Grab it while its still up and free! Description: Remaking the Legend - Halo 2: Anniversary is a full-length documentary chronicling …

610
Free Weekend Play: World of Warcraft @ Worldofwarcraft (Existing Accounts)

expired Free Weekend Play: World of Warcraft @ Worldofwarcraft (Existing Accounts)

Enjoy :) Announcement @ Twitter Welcome Back Weekend Return Free* Through June 24 GET BACK IN THE FIGHT Battle for Azeroth™ fast approaches and you're needed back on the front …

1850
[Steam Key & DRM-Free] Hacknet - Deluxe - FREE @ Humble Store (Was US $14.99)

expired [Steam Key & DRM-Free] Hacknet - Deluxe - FREE @ Humble Store (Was US $14.99)

Runs on Windows, Mac and Linux. To redeem the free game you need to have your Steam account linked to your Humble account. Very Positive reviews on Steam

530
Cancer Council Men's Cabarita Polarised Sunglasses - Gold/Tortoise Shell $9.99 Plus Delivery @ Scoopon

expired Cancer Council Men's Cabarita Polarised Sunglasses - Gold/Tortoise Shell $9.99 Plus Delivery @ Scoopon

Spotted that there was a further reduction From $14.99 to $9.99 on the glasses from an earlier post by save50 Postage is $6.95 Cancer Council Men's Cabarita Polarised Sunglasses - …

860
MX500 500GB $172, MX500 250GB $105.6, MX500 1TB $319.2, SanDisk 240GB $96, Intel 535 360GB $119.2 Shipped + More @ PC Byte eBay

expired MX500 500GB $172, MX500 250GB $105.6, MX500 1TB $319.2, SanDisk 240GB $96, Intel 535 360GB $119.2 Shipped + More @ PC Byte eBay

PRINT

The cheapest price I can find in the market. Crucial MX500 250GB 2.5" SSD $105.60 Delivered @ PC Byte eBay Crucial MX500 500GB 2.5" SSD $172 Delivered @ PC Byte eBay Crucial MX500 1TB …

510

expired Microsoft Rewards: $5 JB Hi-Fi, Myer, David Jones and Coles eGift Cards - 5,135 Points Each

New rewards added 5,135 points for these eGift cards, not as good value as Microsoft dollars however. Might help if you have heaps of points and don't want any of the other rewards. David …