munkybutlers » deal and competition votes

120
Oral-B Electric Toothbrush Heads 16pk: Sensitive Clean $51.50, Precision Clean $48 + Del ($0 Direct to Boot) @ Woolworths Online

expired Oral-B Electric Toothbrush Heads 16pk: Sensitive Clean $51.50, Precision Clean $48 + Del ($0 Direct to Boot) @ Woolworths Online

Sorry, new to posting so unsure of how to write descriptions. $3 for precision and $3.22 per head for sensitive is pretty good from what I've seen. Bonus bargain points if you haven't used …

450
Crest Bon Voyage GaN USB-C PD Travel Adaptor Charger: 30W $19, 45W $24, 65W $34 + Del ($0 OnePass/ C&C/ In-Store) @ Officeworks

Long Running Crest Bon Voyage GaN USB-C PD Travel Adaptor Charger: 30W $19, 45W $24, 65W $34 + Del ($0 OnePass/ C&C/ In-Store) @ Officeworks

Combine with the free 2 hour delivery offer which ends tomorrow. Expired 60% off RRP$59.95 45W, 57% off RRP$79.95 65W. Sells for full price at BIG W, it is NOT a generic Officeworks brand. This is a …

780
Makers Mark Kentucky Bourbon Whisky 700ml $49.41 (RRP $75.42) Delivered @ Amazon AU (OOS) / $49.40 (Club Price) @ Dan Murphy's

expired Makers Mark Kentucky Bourbon Whisky 700ml $49.41 (RRP $75.42) Delivered @ Amazon AU (OOS) / $49.40 (Club Price) @ Dan Murphy's

Makers Mark Kentucky Bourbon Whisky 700ml on Amazon @ $49.41 (RRP $75.42) Delivered Sold Out Half decent whisky at a half decent price delivered. Dan murphy's has price matched online only for …

580

out of stock [Prime] UGREEN 6-in-1 USB C Docking Station with 4K@60Hz HDMI, 100W PD $48.99 Shipped @ UGREEN GROUP via Amazon

Finally a good price for a 100w dock. Review 1: random devices Review 2 Review 3 : does not appear to work well for legion go Reddit thread suggests the ally doesn’t sit perfectly in it but can …

510

expired Crucial T500 2TB PCIe Gen 4 NVMe M.2 2280 SSD $174.96 (2 For $328.92) Delivered @ Amazon US via AU

Stack with the 6% off GCX gift card deal to get a final price of $164.46 (1 drive) and $309.18 (2 drives) Significant price drop from the earlier deal for this top tier drive Tom's review: T500 …

120

out of stock MSI Katana GF66 12UC-692AU Gaming Laptop: 15.6", i5-12450H, 8GB RAM, 512GB SSD, RTX3050, Win11 Home $999 Delivered @ Amazon AU

Looks like the best price I could see right now for this particular laptop and spec, and looks like a good deal, maybe, possibly.. MSI Gaming laptop quality notwithstanding wrt recent comments. 12th …

200
[Android, iOS] Iron Marines Invasion $1.59 (iOS Expired: $1.49, Was $4.89) @ Google Play / Apple App Store

expired [Android, iOS] Iron Marines Invasion $1.59 (iOS Expired: $1.49, Was $4.89) @ Google Play / Apple App Store

A 67% discount for the Iron Marines sequel that was just released in September this year. I haven't played it, but its got a pretty good rating of 4.7 from 4.18k reviews. Time to use up some …

260
25% off Exclusive Bundles + Delivery (Free over $50) @ iFixit

expired 25% off Exclusive Bundles + Delivery (Free over $50) @ iFixit

CELEBRATE

Been looking for one of these kits for work, good savings and local stock it seems. Not sure when it ends Pro Tech Bundle - $118.49 Gamer Bundle - $138.74 DIYer Bundle - $73.49 Electronics Repair …

1230
Chris Rock - Live - $79 + $5.95 Booking Fee (9-20 August, Gold Coast, Brisbane, Sydney, Melbourne, Adelaide) @ Lasttix

expired Chris Rock - Live - $79 + $5.95 Booking Fee (9-20 August, Gold Coast, Brisbane, Sydney, Melbourne, Adelaide) @ Lasttix

Got this email this morning. Saw him in Melbourne 5 years ago and it was a good show, in fact it was excellent. You have to lock your phones away with those cases as likely recorded as a Netflix …

610

expired [Prime] 3M P2 Particulate Vertical Flat Fold Disposable Respirator: 3 for $8.37, 5 for $11.17, 25 for $48.72 Del'd @ Amazon AU

Almost best historical price on these masks for Prime day. Stock up for high current case counts if you care. 3 for $8.37/5 for $11.17/25 for $48.72

110

expired [Prime] Razer Viper Ultimate Wireless Mouse with Charging Dock $114 Delivered @ Amazon AU

Great value if you want a high-end wireless mice. Well reviewed, many comparisons and comments in previous deals. I personally prefer the benefits of an 8000Hz mouse, but no deals on the Razer Viper …

260

expired [Prime] Razer Basilisk X HyperSpeed Wireless Ergonomic Gaming Mouse $45 Delivered @ Amazon AU

Part of Amazon Prime Day Deal Razer Basilisk X HyperSpeed Untethered Lethal Precision Game wirelessly with a fast, reliable connection—featuring dual-mode Razer HyperSpeed Wireless and Bluetooth …

70

expired Razer DeathAdder V2 Pro Wireless Gaming Mouse $119 Delivered @ Amazon AU

Not the cheapest but still a good buy. I have the DeathAdder Elite and planning to replace it with this wireless mouse for work and casual gaming. It doesn't have the double click issue due to …

450

expired 3M 9123 P2 Particulate Vertical Flat Fold Disposable Respirator 3-Pack $5.90 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

After one month, back to stocks. About this item AS/NZS 1716: Meets Australian and New Zealand standards Easy breathing with four-layer, 3D design Disposable Respirator 3M P2 Particulate Respirator …

920

expired Sequence Board Game $20 + Delivery (Free C&C/ in-Store) @ BIG W

Test your strategic skills in the classic board game, Sequence. Learn to block your opponents and remove their chips - but you'd better watch out for the Jacks! Exciting and challenging, …

150
Up to 25% off Sitewide Anime, Merch & Manga, $7 Shipping ($0 for Orders of $75 or More) @ Madman

expired Up to 25% off Sitewide Anime, Merch & Manga, $7 Shipping ($0 for Orders of $75 or More) @ Madman

We're taking up to 25% off sitewide*! There are thousands of products across Anime Blu-ray/DVD, Merch, Manga and more to choose from! Hurry, these bargains won’t last for long! Exclusions …

19670
[iOS] Paramount Plus Subscription for $5.99/Year (iOS App Required)

expired [iOS] Paramount Plus Subscription for $5.99/Year (iOS App Required)

Seems like there is a pricing error for Paramount+ on the Apple ecosystem. Need an iOS device to take advantage. Instructions: Download the Paramount App on iOS Sign up to a Monthly subscription …

2220
[Zip] Spend $150 with Zip Pay or Zip Money, Get $30 Back @ JB Hi-Fi

expired [Zip] Spend $150 with Zip Pay or Zip Money, Get $30 Back @ JB Hi-Fi

No end date mentioned, but similar to other BNPL offers at JB in the past Mod: *Spend $1​50 or more in one transaction at JB HI-FI using your Zip Pay or Zip Money Account to earn $​30 …

940
Logitech G733 Gaming Headset $149.50, G305 Mice $49.50, G203 Mice $34.50 (Lilac/ Blue Only) + Post ($0 C&C/ in-Store) @ JB Hi-Fi

expired Logitech G733 Gaming Headset $149.50, G305 Mice $49.50, G203 Mice $34.50 (Lilac/ Blue Only) + Post ($0 C&C/ in-Store) @ JB Hi-Fi

92202672624

Logitech G733 - $149.50 (Was $299) Logitech G305 - $49.50 (Was $99) Logitech G203 - $34.50 (Was $69) Until Thursday get yourself 50% off^ the current ticketed price of a Logitech G733, G305 G203 …

170

expired Razer Goliathus Chroma Extended Mouse Mat Black $50.77 + Delivery (Free with Prime) @ Amazon UK via AU

Razer Goliathus Chroma Extended Mouse Mat Black,Black,RZ02-02500300-R3M1 Powered by Razer Chroma lighting with 16.8 million customizable color options Micro-textured surface balanced for speed and …

2120
Dell S2721D 27" IPS Monitor (QHD 2560x1440 @ 75 Hz) $247.20 (Was $429) Delivered @ Dell eBay

out of stock Dell S2721D 27" IPS Monitor (QHD 2560x1440 @ 75 Hz) $247.20 (Was $429) Delivered @ Dell eBay

PDELL20A

Quantity will be updated to 500 units on the eBay listing @ 3pm. No need to report as product is NOT out of stock Need Coffee, Oh Hi. Another mid October Dell deal for you guys. The awesome S2721D. …

100

expired Sofirn Sp33v3 Torch/Flashlight $50.14 Delivered (Save 15%) @ Sofirnlight via AmazonAU

Z228VKYH

Sofirn has sent some more lights to AmazonAU warehouses, and have given me a code for a discount on it to share. This time it's for the SP33v3; this particular light is in a kit with USB cable …

500
LIFX Mini Day & Dusk Tunable White 2-Pack E27/B22 $49.99 (Was $85.99) @ Bunnings (~42% off RRP)

expired LIFX Mini Day & Dusk Tunable White 2-Pack E27/B22 $49.99 (Was $85.99) @ Bunnings (~42% off RRP)

Amazing value 800 lumens. Works with Alexa, Google and Apple HomeKit. Works out to $25 each. Bargain! Available in E27 (Edison Screw) or B22 (Bayonet).

71
[eBay Plus] Seagate Firecuda 520 500GB $158, Seagate Barracuda 510 1TB $220.41, MSI GeForce RTX 2070 Super X $836 Del @ SE eBay

expired [eBay Plus] Seagate Firecuda 520 500GB $158, Seagate Barracuda 510 1TB $220.41, MSI GeForce RTX 2070 Super X $836 Del @ SE eBay

PARTY21

Seagate Firecuda 520 500GB $158 after + redeem Seagate recovery service for 2 years Seagate Barracuda 510 1TB M.2 Nvme SSD $220.41 + redeem Seagate recovery service for 2 years MSI GeForce RTX 2070 …

1730

expired Crucial P1 1TB NVMe SSD $94.34 + Free Delivery @ Austin Computers Amazon AU

Came across this while looking for a new SSD. Lowest I have seen so could be a mistake. They also have the WD Black 1tb for $178.08 only 4 of those remaining though. I ended up buying the WD …

460
HyperX Cloud Stinger Gaming Headset $63 @ JB Hi-Fi

expired HyperX Cloud Stinger Gaming Headset $63 @ JB Hi-Fi

Was looking for a cheap gaming headset to replace me old one which broke and saw these on sale. Not the cheapest price ever but it'll do the job. The Cloud II and Cloud Alpha Headsets are also …

290
Mega Movie Week: Movies to Own from $5 @ Google Play Store

expired Mega Movie Week: Movies to Own from $5 @ Google Play Store

Hey All. Another Movie Sale on @ Google Play but with Movies to Own this time on Sale. Scroll down to 2nd & 3rd Banners for the Sale :)

1241
50% off a Wide Selection of Ray-Ban - Starting from $87.50 ($112.50 for Polarized) Delivered @ Myer

expired 50% off a Wide Selection of Ray-Ban - Starting from $87.50 ($112.50 for Polarized) Delivered @ Myer

Half price Ray Ban is on again at Myer, similar to the previous deal, but this time starting from $87.50. Also half price kids Ray Ban starting from $45 $50-$100 range $100-$200 range Other …

1120
Apple AirPods 2nd Gen with Charging Case $199 Delivered @ Officeworks

expired Apple AirPods 2nd Gen with Charging Case $199 Delivered @ Officeworks

Looks like they've matched BIG W. Stay safe and enjoy :)

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

810

expired Selected 4K Blu-Ray Titles (John Wick 2, Blade Runner 2049, etc) for $7.82 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Many 4k Blu-rays available at amazon today for $7.82. I don't recall seeing anything this low before. These are all 4k: $6.70 - Baby Driver - Twilight (2008) $7.37 - John Wick: Chapter …

220
SSD Sale: Samsung 860 QVO SSD 1TB $165, 860 EVO 500GB $125, 860 EVO 1TB $218 + Del @ Shopping Express

expired SSD Sale: Samsung 860 QVO SSD 1TB $165, 860 EVO 500GB $125, 860 EVO 1TB $218 + Del @ Shopping Express

Samsung 860 QVO 1TB $165 Samsung 860 EVO 500GB $125 Samsung 860 EVO 1TB $218 Samsung 970 EVO Plus 500GB $170 Samsung 970 EVO Plus 1TB $329 Free Game by Redemption

780
[PC, Mac] Kaspersky Total Security 2020 - 3 Devices - 1 Year License Key for $13.99 @ Device Deal

expired [PC, Mac] Kaspersky Total Security 2020 - 3 Devices - 1 Year License Key for $13.99 @ Device Deal

Works for Both PC and Mac - Key Only - for Three Devices Codes being emailed from 9am Monday, 500+ to work through but they are on their way Multi-device family security – with antivirus, …

60

expired Silicon Power 32GB (2x 16GB) 3200MHz CL16 $289.99, 128GB J80 Flash Drive $35.99 + Post ($0 Prime/ $39) @ Silicon Power Amazon AU

Silicon Power STOCK CLEARANCE SALE @Amazon AU Silicon Power 32GB (16GBx2) XPOWER RGB Turbine Gaming DDR4 3200MHz (PC4 25600) 288-pin CL16 1.35V UDIMM Desktop Memory Module - Low Voltage $289.99 + …

730
[Android] Kingdom Rush Vengeance $1.89 (Was $7.49) @ Google Play Store

expired [Android] Kingdom Rush Vengeance $1.89 (Was $7.49) @ Google Play Store

Found this while I was browsing for games to be played during self isolating/ work from home. The 4th installment of kingdom rush - The most popular tower defense franchise is back and it’s …

2140

expired Samsung BAR Plus 128GB USB 3.1 Flash Drive $29 @ Bing Lee or [eBay Plus] Free Delivery @ eBay Bing Lee

Great Price. Enjoy :) Try your luck to Pricematch with other stores JB, HN etc eBay Bing Lee & Free delivery for eBay Plus Members Thanks to RobinWyt & RogueWolf Price Compare : $49 @ …

3850
Burritos and Bowls $9.90 @ Guzman Y Gomez (Mobile App)

expired Burritos and Bowls $9.90 @ Guzman Y Gomez (Mobile App)

Right now we know you need access to clean, healthy food more than ever so we are reducing our burritos and bowls to $9.90! Yes, you heard right, our regular sized BURRITOS and BOWLS (not our …

230
Get All of Foxtel Now for 3 Months on Us @ Telstra (My Offers)

expired Get All of Foxtel Now for 3 Months on Us @ Telstra (My Offers)

check your telstra account/My Offers, most should have it if on the $90 bundle, looks like its all channels on foxtel now "Get all of Foxtel Now for 3 months on us when you sign up to an …

480
JVC KWM750BT Double DIN Head Unit - Apple Carplay/Android Auto $294 @ Supercheap Auto

expired JVC KWM750BT Double DIN Head Unit - Apple Carplay/Android Auto $294 @ Supercheap Auto

AFTERPAY

Save yourself a hefty fine for touching your phone whilst driving! This could pay for itself. Thanks to @doweyy for original Supercheap post, using code AFTERPAY for 30% off on purchases over $200, …

230
AMD AM4 Ryzen 7 3700X $437, MSI Radeon RX 5700 XT Mech OC $559, MSI B450 Tomahawk Max $181 Delivered @ Shopping Express

expired AMD AM4 Ryzen 7 3700X $437, MSI Radeon RX 5700 XT Mech OC $559, MSI B450 Tomahawk Max $181 Delivered @ Shopping Express

Extra 10% off Motherboards when combined with AMD CPU purchase Discount shows at checkout MSI B450 Tomahawk Max Motherboard $181 MSI Radeon RX 5700 XT Mech OC $559

150
[Android] Free - Smart Riddles - Brain Teaser word game, Math Puzzle | Riddle Zone - Logic Challenge Game, etc @ Google Play

expired [Android] Free - Smart Riddles - Brain Teaser word game, Math Puzzle | Riddle Zone - Logic Challenge Game, etc @ Google Play

** Apps and Icon Packs now separate ** 2020-02-12 Apps A P App Was ★ 👤 A •    Smart Riddles - Brain Teaser word game $4.79 4.8 31 A …

1940

expired TP-Link HS100 Smart Plug - $19 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Price matching Officeworks and Aus Post, but prime members get it delivered free 🙂 Post number 2000 😁 Industry leading 3-year warranty and 24/7 technical support