swimmingtoad » deal and competition votes

720
AMD Ryzen 5 3600 $285, 7 3700x $499 + Delivery @ Shopping Express

expired AMD Ryzen 5 3600 $285, 7 3700x $499 + Delivery @ Shopping Express

Currently have a 3600/2070s build in mind and have seen that shopping express have dropped the price of both 5 and 7 series chips listed… Is this enough words (first time poster)???

08
Maxcare Hand Sanitiser 100ml X 12 Pack $50 @ Tobe.com.au

expired Maxcare Hand Sanitiser 100ml X 12 Pack $50 @ Tobe.com.au

Many of us have been seeing hand sanitisers & face masks being sold at ridiculous prices for the last 2 months. The main reason is the high market demand and short supply of bottles especially …

220

expired [Switch] Sid Meier's Civilization VI $39.99 Delivered @ Game Gadgetz via Amazon AU

First time poster, scored many deals in the past with the help of this great community. Keep up the good work and be gentle if I messed something up… Duplicate link, but $10 cheaper than …

200
Sunbeam Specialty Brew 8100 $74.25 (RRP $99) Delivered @ Myer

out of stock Sunbeam Specialty Brew 8100 $74.25 (RRP $99) Delivered @ Myer

Folks, just thought that some of you might like this. I was on the hunt for a drip filter coffee machine and, yes, we know what many people think of them, but there is a convenience, and the better …

570
[WA] Ben and Jerry's Ice Cream Slices $0.50 @ Spudshed

expired [WA] Ben and Jerry's Ice Cream Slices $0.50 @ Spudshed

Once again for WA users, spudshed morley is clearing out ben and Jerry's slices. Grabbed some last week for $1, now they're down to 50c. Definite supply at morley

190
[PC] Star Wars Jedi - Fallen Order $43.49 (after $15 Coupon) @ Epic Games

expired [PC] Star Wars Jedi - Fallen Order $43.49 (after $15 Coupon) @ Epic Games

Didn’t see it listed in the other post but the last steam sale was $53.97 so this is the best price so far for the game. Edit: thanks for the correction. you get the coupon by either claiming (as …

310
$0 Delivery | Pirate Life Pale 16pk $49.95 (VIC/SA), Belhaven Scottish 6pk $15, Adnams Ghost Ship Pale 4pk $11 @ My Dan Murphy's

expired $0 Delivery | Pirate Life Pale 16pk $49.95 (VIC/SA), Belhaven Scottish 6pk $15, Adnams Ghost Ship Pale 4pk $11 @ My Dan Murphy's

WMFREE

ending Wednesday 27th May: Hoegaarden White Beer 330mL 4pk $10/$11 BeerAdvocate 86pts, RateBeer 84-98pts Feral Hop Hog Pale Ale 330mL 4pk $14/$15 BeerAdvocate 93pts, RateBeer 96-98pts Adnams Ghost …

590
Allocacoc PowerCube for $10 @ Officeworks

out of stock Allocacoc PowerCube for $10 @ Officeworks

$10 for Allocacoc PowerCube 5 Power Outlets 1.5 mtr Red.

380

out of stock Steamrail Summer Ale 24×330ml $35 + Delivery ($0 with C&C /In-Store) @ First Choice Liquor

I thought this was a good deal when I was in First Choice Liquor earlier. Good beer for $35. Far better than the Arc Valley / Hammer N Tongs cheapies. Edit 1/6: Appears no delivery to QLD.

1960
Apple AirPods Pro $349 Delivered @ Mobileciti

expired Apple AirPods Pro $349 Delivered @ Mobileciti

ArsePods

Hey guys. Nice price on the AirPods Pro from our friends at Mobileciti. Price includes free shipping which will be dispatched immediately from their Parramatta store. Guaranteed Australian stock (no …

580

out of stock [Back Order] ASUS AM4 TUF Gaming X570-Plus ATX Motherboard $285.88 + Delivery ($0 Delivery with Prime) @ Amazon US via AU

With B450 not supporting Zen3 upgrades, the x570 becomes more attractive. I expect the B550 to be a bit more expensive than the decent B450 boards ~ $200 to $250, X570 still has a place as the VRM …

540
Shop Woolworths Cook Range and Get 10x Bonus Points @ Woolworths (Activation Required)

expired Shop Woolworths Cook Range and Get 10x Bonus Points @ Woolworths (Activation Required)

Shop the Woolworths COOK range and scan your Rewards card for 10x points. Offer ends Thursday, 11th June.* Possibly useful for stacking with other points deals. I also received an email with a bonus …

700
Galax GeForce RTX 2070 SUPER 8GB GDDR6 Video Card $769 + Delivery @ Shopping Express

expired Galax GeForce RTX 2070 SUPER 8GB GDDR6 Video Card $769 + Delivery @ Shopping Express

Saw this deal in the epic hour section over at shopping express (https://www.shoppingexpress.com.au/view/epic-hour/) I recently bought a few parts of shopping express and shipping took 3 days (I …

3270
CommBank Rewards - $15 Cashback on $30+ Spend @ Menulog (Cashback and Spending Requirements May Vary)

expired CommBank Rewards - $15 Cashback on $30+ Spend @ Menulog (Cashback and Spending Requirements May Vary)

Hi everyone! New Menulog offer from CommBank rewards. Check the rewards section of the CommBank app. Offer may be targeted. How to claim (Copied from deal page): Activate before you spend Shop …

23020
[PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

expired [PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …

141
Qantas Premier Platinum Mastercard, $299 Annual Fee, 100k Qantas Points, 75 Status Credits, 2 Qantas Lounge Passes

expired Qantas Premier Platinum Mastercard, $299 Annual Fee, 100k Qantas Points, 75 Status Credits, 2 Qantas Lounge Passes

Probably not as great as the previous/other credit card deals, but might still be of interest to some people. Previous deal for reference. "Earn 80,000 bonus points when you spend $5,000 or …

10

expired INNObeta 300ml Diffuser for Essential Oil with LED $17.49 + Delivery ($0 with Prime/ $39 Spend) 50% off @ Bestore Amazon AU

INNODIFUS

INNObeta Ultrasonic Essential Oil Diffuser Lovely Fragrance, Better Breathe Let the INNObeta Ultrasonic Diffuser gently vaporizes your favorite essential oils and preserves their most powerful …

850
[Switch] NBA 2K20 385¥ ($5.50) @ Nintendo eShop Japan ($89.95 in Nintendo eShop Australia)

expired [Switch] NBA 2K20 385¥ ($5.50) @ Nintendo eShop Japan ($89.95 in Nintendo eShop Australia)

NBA 2K20 on 95% sale @ Nintendo eShop Japan. This should be the lowest price for this game. Create Japanese PayPal Account to purchase this. VPN not …

1820
[PS4] NBA 2K20 - $7.55 @ PS Store

expired [PS4] NBA 2K20 - $7.55 @ PS Store

Not quite as cheap as Xbox, but still good if this is your platform of choice

1510

expired Romoss Type-C USB PD & QC 3.0 18W 20000mAh Power Bank $27.99, 10000mAh $23.19 + Delivery ($0 with Prime/$39+) @ Romoss Amazon AU

KIEDD5OS

Back again with a Romoss power bank deal and this time we have a total of 5 power banks - 3 with fast charging and 2 with standard charging. Both 20000mAh (SW20PS+, Sense 6PS+) and the 10000mAh …

110
Raco - Stainless Steel Copper BASED 5pc Cookware Set $89.00 + Delivery @ Victoria's Basement/Amazon

out of stock Raco - Stainless Steel Copper BASED 5pc Cookware Set $89.00 + Delivery @ Victoria's Basement/Amazon

Also listed on Amazon: https://www.amazon.com.au/RACO-Copper-Piece-Cookware-Set/dp/... Been looking for a good cookware set, stainless steel with a copper base for quicker heat transfer and found …

1590
[XB1, XB360] Daytona USA $2.48 (Was $9.95) | Crazy Taxi $2.48 @ Microsoft AU

expired [XB1, XB360] Daytona USA $2.48 (Was $9.95) | Crazy Taxi $2.48 @ Microsoft AU

Great price for this classic arcade game. Day-tooooooooon-naaaaaaaaaaaaaaaaa It’s time to get revved up with Daytona USA! Based on the classic arcade title, Daytona USA features enhanced …

23
[ACT] Free Whole Space Sanitising for Health Care Professionals @ Mr Guru Canberra

expired [ACT] Free Whole Space Sanitising for Health Care Professionals @ Mr Guru Canberra

Mr Guru offers whole space sanitising service to minimise risks. Mr Guru use TGA approved, PH-neutral Hospital Grade Disinfectant/Sanitiser, and apply with the fogging machine. (Mod: Removed …

410
[PC] Railway Empire $17.48 (Was $69.95) @ Steam

expired [PC] Railway Empire $17.48 (Was $69.95) @ Steam

All time lowest price for a Very Postive rated transport game. In Railway Empire, you will create an elaborate and wide-ranging rail network, purchase over 40 different trains modeled in …

760
Cricketers 6 x 330ml $10, Pirate Life Acai & Passionfruit Sour 355mL x 4 $10, Angostura Bitters 200mL $17 @ Dan Murphy's Members

expired Cricketers 6 x 330ml $10, Pirate Life Acai & Passionfruit Sour 355mL x 4 $10, Angostura Bitters 200mL $17 @ Dan Murphy's Members

Prices may vary. I'm guessing $10 or $11 if your state/territory has a CDS. Some more discounts I've noted for the month of May. I've been making quite a few Old Fashioneds lately so …

820
Earn 400 Points on $20 Google Play or Netflix Gift Card | 1000 Points on $50 Google Play, Uber or Netflix Gift Card @ Woolworths

expired Earn 400 Points on $20 Google Play or Netflix Gift Card | 1000 Points on $50 Google Play, Uber or Netflix Gift Card @ Woolworths

Earn 400 Points (Worth $2) on $20 Google Play or Netflix Gift Cards May not be available in all stores. Colours, sizes and styles may vary by store. While stocks last. Available on all …

660
Breville BES870BSS The Barista Express Coffee Machine $549 (Was $649) @ Costco (Membership Required)

expired Breville BES870BSS The Barista Express Coffee Machine $549 (Was $649) @ Costco (Membership Required)

Costco Breville BES870BSS $549 , after instant rebate . Normally $649.00 . Which is still cheaper then most retailers . Barista Pro touch BES878BSS Down to $800. Membership Required !

660
[VIC] 50% off Storewide @ Priceline - 235 Bourke Street, Melbourne [In-store Only]

expired [VIC] 50% off Storewide @ Priceline - 235 Bourke Street, Melbourne [In-store Only]

Saw this while walking around Melbourne CBD. 235 Bourke street Priceline. Staff said closing down sale. From 9th May until stock runs out or 5th June. 2/6: Now 80% off

840
[VIC] Maggie Beer Complete Paste Collection - 5x100gm $4.97 (RRP $25.00) @ Costco Docklands (Membership Required, in-Store Only)

expired [VIC] Maggie Beer Complete Paste Collection - 5x100gm $4.97 (RRP $25.00) @ Costco Docklands (Membership Required, in-Store Only)

From the box: Maggie Beer's Complete Paste Collection is the perfect collection for cheese lovers with the choice of Quince, Fig & Fennel, Spiced Pear, Plum, and Cabernet Pastes. The box …

191
[Refurb] Jabra Elite 75T Black $182.24 Delivered @ onlinedeal2015 eBay (Free Shipping)

expired [Refurb] Jabra Elite 75T Black $182.24 Delivered @ onlinedeal2015 eBay (Free Shipping)

PILLOW10

Original Coupon Deal First time poster disclaimer - $182 w/ Pillow10 Discount Code I have been on the hunt for Jabra 75T's for a while now ever since the sale on Qantas. Repoguys on Ebay have …

830
MSI Radeon RX 5700 XT MECH OC 8GB GDDR6 Graphics Card $598 + Delivery @ ShoppingExpress

expired MSI Radeon RX 5700 XT MECH OC 8GB GDDR6 Graphics Card $598 + Delivery @ ShoppingExpress

Seems to be the cheapest decent 5700XT at the moment. All others are $700+ which means this is a good 15% off. HardwareUnboxed Review

4000
[PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

expired [PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

Free while supplies last or until 3am AEST on Monday the 11th of May. There is also a key redemption deadline of 3am AEST on Friday the 15th of May after you've claimed the game. As usual with …

170

out of stock Harris Premium Whole Coffee Beans - Roasted in Sydney - 1kg X 3 Packs $41 Delivered @ Amazon AU

My first post so be kind please :-) Woolworths has it for $15 each at the moment. I had a few dollars of Amazon credit so it worked out pretty cheap for me. Best Amazon deal on what I personally …

180
Tasmanian Heritage Soft Cheeses 250g $5.90 (save $5.90) including Ash Brie @ Coles

expired Tasmanian Heritage Soft Cheeses 250g $5.90 (save $5.90) including Ash Brie @ Coles

I don't know why I love paying for inedible food haha but this Ash Brie is so good and cheaper than the current Coles/woolies cheap soft cheese. The other types (brie, Camembert etc) are likely …

180
FFalcon 50UF1 50" 4K Ultra HD LED Smart TV $398 C&C /+ Delivery @ JB Hi-Fi

expired FFalcon 50UF1 50" 4K Ultra HD LED Smart TV $398 C&C /+ Delivery @ JB Hi-Fi

RED HOT DEAL! Back in stock just in time for Mother's Day! Spoil your mum on the cheap with 50 inches of viewing pleasure! FFalcon 50UF1 50" 4K Ultra HD HDR LED Smart TV Model: …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

410

out of stock Fountain Tomato Sauce 4L $6 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

This is at its lowest price. It is $1.50 cheaper than the last post. https://www.ozbargain.com.au/node/533235 Even though it is currently temporarily out of stock, you can still order. Order now …

70
Bosch 90cm Series 6 Gas Cooktop with FlameSelect PCR9A5B90A $1159 Delivered @ Powerland

expired Bosch 90cm Series 6 Gas Cooktop with FlameSelect PCR9A5B90A $1159 Delivered @ Powerland

Size & Power 5 Gas burners Dual flame wok burner 1 High-speed, 2 Standard, 1 Economy, 1 Dual Wok Burner Left rear: Standard burner 6.85 Mj/h Right rear: High-speed burner 11 Mj/h Center front: …

430

expired Quest Nutrition Protein Bar 60g x12 (Cookie Dough/Brownie/Doughnut/Mint) $21.60 + Delivery ($0 w/ Prime/ $39 Spend) @ Amazon AU

Good deal on these. RRP for around $30-40 a box, or $2.70 individually (on sale, 10+) at Chemist Warehouse. S&S was a bit finnicky on this. It didn't appear on the deal until I refreshed …

1020
2080 Super Gaming PCs: R5-3500X: $1788 / R5-3600: $1888 / R7-3700X: $2088 + Delivery @ TechFast

expired 2080 Super Gaming PCs: R5-3500X: $1788 / R5-3600: $1888 / R7-3700X: $2088 + Delivery @ TechFast

3500X-2080S-MAY3600-2080S-MAY3700X-2080S-MAY

Hi all, This is our lowest possible pricing for Ryzen 5 and Ryzen 7 / RTX 2080 Super combos at current currency exchange and supplier pricing (current retail price for 2080 Super is $1199 at …

710
Google Pixel 4 64GB Clearly White $799 @ Google Store

out of stock Google Pixel 4 64GB Clearly White $799 @ Google Store

Google is running a deal for just the Pixel 4 64gb clearly white at $250 off RRP. I currently use the 4XL and love it but battery may be an issue with the standard 4.

1430
Google Pixel 3 128GB $499 + Delivery (Free C&C/In-Store) @ JB Hi-Fi

out of stock Google Pixel 3 128GB $499 + Delivery (Free C&C/In-Store) @ JB Hi-Fi

Specs GSMArena 5.5 FHD+ (443 ppi) P-OLED display Android 10 Snapdragon 845 octa core, Adreno 630 128GB internal storage, 4GB RAM Main cam: 12.2 MP, Secondary cam: 8 MP 2915 mAh battery IP68 water …

370

out of stock Dettol Anti-Bacterial Hand Wash Refresh Refill Disinfecting 950ml $6.50 (Min 2 Purchase) @ Amazon (+Shipping/$0 Prime/Spend $39)

Finally, the care and protection against germs that your family deserves, to help keep your hands healthy Our new formula not only kills 99% of germs, but is also clinically tested to keep your skin …

801
Medibank - Join Any Hospital+Extras Cover and Get 6 Weeks FREE + 2 & 6 Months Waiting Period Waived

expired Medibank - Join Any Hospital+Extras Cover and Get 6 Weeks FREE + 2 & 6 Months Waiting Period Waived

6FREE

Join eligible combined hospital & extras cover and you could enjoy six weeks free plus 2&6 months waiting periods waived on extras. New members only. ‡ Must use promo code: 6FREE I just …

1580

expired Under Armour 30% off Almost Sitewide (Including Sale Items) or Take $20 off $50+ Spend

BDAY30EFCMEMBERS20

Extra $20 off for over $50 spend with code EFCMEMBERS20 available now thanks to 4iedemon and cykoman Update: EFCMEMBERS20 can no longer be combined with BDAY30 coupons. (keep in mind, will probably …

232
Sani-Gel Instant Hand Sanitiser 70% Alcohol Pump Bottle 500ml $9.22 + Delivery @ Pet Station

expired Sani-Gel Instant Hand Sanitiser 70% Alcohol Pump Bottle 500ml $9.22 + Delivery @ Pet Station

Hi guys, We managed to get 190 bottles of Sani-Gel instant hand sanitiser from our supplier, We are offering this at our cost price to hopefully help people that are in need, We understand that …

200
ASUS TUF VG27AQ 27" 165hz WQHD HDR10 IPS G-Sync Compatible Gaming Monitor $619 + Delivery @ Skycomp

expired ASUS TUF VG27AQ 27" 165hz WQHD HDR10 IPS G-Sync Compatible Gaming Monitor $619 + Delivery @ Skycomp

Been looking for a high end gaming monitor. Tossing up between LG 27GL850 and this to pair with RTX 2070 Super ~Bit of a wait though - 8-12 weeks~ ASUS TUF VG27AQ 27" 165Hz WQHD HDR10 IPS …

140
Yellowfin Tuna Steak $35/Kilo. Coles Burwood/ Vic

expired Yellowfin Tuna Steak $35/Kilo. Coles Burwood/ Vic

I saw this at the deli/seafood section last weekend at Coles Burwood. I thought for sure that some ozbargainer would be posting this up so I left it. A week later and I've seen nothing! Shame on …

1570
Philips 4K 50" Slim Smart LED TV $399 @ ALDI

expired Philips 4K 50" Slim Smart LED TV $399 @ ALDI

Unfortunately there's no model specified in the catalogue. Appears to be the 50PUT6103/79 just googling and looking for a similar stand and branding. Since it's "no longer …

950
Samsung T5 Portable SSD: 500GB $111.20 | 1TB $239.20 Delivered @ Microsoft eBay

expired Samsung T5 Portable SSD: 500GB $111.20 | 1TB $239.20 Delivered @ Microsoft eBay

PPCMS20

Edit - T5 1TB Deep black back in stock. Microsoft are having a 20% off selected items sale on ebay. Samsung T5 - 500GB Portable SSD - Alluring Blue - $111.20 Samsung T5 - 500GB Portable SSD - …