taitems » deal and competition votes

11
Win a $1000 Crypto Portolio + More from Coinstash

closed Win a $1000 Crypto Portolio + More from Coinstash

  • Australia-wide
  • Website
  • Account/Membership, Email Subscription, Like/Follow/Comment/Share, Recruit/Referral
780
25 Free AWS, Azure, GCP, Linux, DevOps & Python Courses @ A Cloud Guru

expired 25 Free AWS, Azure, GCP, Linux, DevOps & Python Courses @ A Cloud Guru

For the month of Jan, a cloud guru has 25 free cloud and devops training courses. Topics cover aws, azure, gcp, kubernetes, python and devops. AWS How to Properly Secure an S3 Bucket Choosing the …

1140
10% off Apple MacBook Pro @ JB Hi-Fi

expired 10% off Apple MacBook Pro @ JB Hi-Fi

It seems stock for Macbook Pro 2021 are still limited, JB still put the new range on sale. For those who still has discounted GC can stack for better savings… Limited stock, get in quick…

4030
Free: Stream Every Episode of Bluey @ ABC iView

expired Free: Stream Every Episode of Bluey @ ABC iView

Bluey: Every Episode Ever Wackadoo! It's every episode of Bluey EVER! (Naughty ABC omitting the apostrophe in it's.) 130 episodes are listed on Wikipedia (seasons 1 & 2, and half …

1090
First Choice Liquor: 27% Cashback (Capped at $25) 4pm to 10pm @ Shopback

expired First Choice Liquor: 27% Cashback (Capped at $25) 4pm to 10pm @ Shopback

27% cashback for six hours this evening. Unfortunately there doesnt appear to be any sitewide offers of flybuys promos to stack with this time.

9
Win a 12-Month Sock Subscription Worth $180 from Australian Made

closed Win a 12-Month Sock Subscription Worth $180 from Australian Made

  • Prize pool $180.00
  • Australia-wide
  • Website
  • Account/Membership
4820
15% off Ultimate Home, Kids, Thanks, Eats, Beauty & Spa Gift Cards @ Coles

expired 15% off Ultimate Home, Kids, Thanks, Eats, Beauty & Spa Gift Cards @ Coles

From the upcoming Coles catalogue sale starting Wednesday December 8. Limit of 5 gift cards per customer. Full credit to Wookiemonster for the list of retailers - Gift Card Participating …

14
Win $1,000 Worth of Bitcoin and Sydney Swans Prize Pack or 1 of 710 Minor Prizes from Independent Reserve

closed Win $1,000 Worth of Bitcoin and Sydney Swans Prize Pack or 1 of 710 Minor Prizes from Independent Reserve

  • Prize pool $10,874.00
  • Australia-wide
  • Website
1510
[PC, Origin] Free - Battlefield 4: Dragon's Teeth DLC (Was $19.99); Battlefield 1: Apocalype DLC (Was $24.99) @ Origin

expired [PC, Origin] Free - Battlefield 4: Dragon's Teeth DLC (Was $19.99); Battlefield 1: Apocalype DLC (Was $24.99) @ Origin

Free for a limited time. Both have been free in the past: BF4 / BF1 B4 Dragon's Teeth Take infantry warfare to the next level. The theater of war broadens with Battlefield 4 …

1751

expired [PC, Origin] Battlefield V $0.99 @ Cdkeys

20 cents cheaper than the last deal. Can it get any cheaper than this? Codes purchased must be redeemed before the 30th September 2021

79624
Free 3 Month Subscription To The Sizzle For COVID-19 Vaccinated

expired Free 3 Month Subscription To The Sizzle For COVID-19 Vaccinated

Hello Ozbargain! I'm giving away free 3 month subscriptions to my tech newsletter, The Sizzle, for anyone who uploads proof of their COVID-19 vaccination. Normally 3 months costs $15, but as an …

1660
½ Price Mayvers Natural Peanut Butter Varieties 375gm $2.50 @ Woolworths

expired ½ Price Mayvers Natural Peanut Butter Varieties 375gm $2.50 @ Woolworths

Super Tasty Mayver's Smooth Peanut Butter is all natural, just peanuts with a dash of sea salt. No added sugar. Enjoy the wholesome goodness of natural peanuts which have simply been …

1060
[iOS] Remote Control for Mac/PC PRO - Free (Was US $7.99) @ Apple App Store

expired [iOS] Remote Control for Mac/PC PRO - Free (Was US $7.99) @ Apple App Store

A highly rated app with an average of 4.7 out of 5 from 346 reviews. Description Turn your iPhone or iPad into a friendly yet powerful remote control for your computer. Control your computer from …

2062
Free $10 Cryptocurrency When You Signup @ Digital Surge

expired Free $10 Cryptocurrency When You Signup @ Digital Surge

We want to prove that we offer the best platform in Australia with the LOWEST fees and best customer support in the nation (7 days a week live chat). We are cheaper, faster, better, safer and easier …

5310
[VIC] Free Vegetarian Meals for Anyone in Need @ Om Vegetarian Restaurant, Melbourne CBD

expired [VIC] Free Vegetarian Meals for Anyone in Need @ Om Vegetarian Restaurant, Melbourne CBD

Dear Ozbargainers, I was inspired by the recent post from Nilgiri's restaurant in NSW (thank you from the entire community) and given the current circumstances transpiring in Melbourne, we will …

2320
[VIC] Free Delivery during Lockdown (Excluding KFC, Bottle Shops, Deliveries by Restaurant) @ Deliveroo

expired [VIC] Free Delivery during Lockdown (Excluding KFC, Bottle Shops, Deliveries by Restaurant) @ Deliveroo

Deliveroo responses pretty quickly this time Enjoy your free delivery for food during lock down in VIC Screenshot of offer Excludes bottle shops, KFC and restaurants that are marked with …

9800
[NSW] Free Indian Meals for Jobless/Battlers/Elderly/Int Students @ Nilgiri's Indian Restaurant, Cremorne

Long Running [NSW] Free Indian Meals for Jobless/Battlers/Elderly/Int Students @ Nilgiri's Indian Restaurant, Cremorne

Similar to this deal, the owners have reached out to me to post this on their behalf - seriously blown away by the generosity of some people. If the owners decide to make themselves known in the …

330

out of stock Nanoleaf Essentials 2 Meter Lightstrip Starter Kit $55 Delivered @ Amazon AU

A pretty good price on this light strip from Nanoleaf. Usually retails for $99 Compatible with HomeKit an thread enabled for those of us with HomePod Minis. Lowest price tracked on …

2080
[VIC] Free Delivery @ Deliveroo

expired [VIC] Free Delivery @ Deliveroo

We’ve had a great run, Victoria. While it’s a bummer having to cancel plans, this lockdown is also an opportunity to sit back and refresh. Valid from 11:59pm 27/5 To help support local …

1661
[VIC] Melbourne Money Dining Initiative: 20% Rebate with $50-$500 Spend @ City of Melbourne

expired [VIC] Melbourne Money Dining Initiative: 20% Rebate with $50-$500 Spend @ City of Melbourne

While receipts need to be timestamped before midnight tonight, diners have until 11:59pm on Friday 16 July to submit final claims. Eligible Melbourne Money claims that are submitted by Friday will be …

2161
50% off Burgers (National Burger Day) @ Deliveroo (Selected Restaurants)

expired 50% off Burgers (National Burger Day) @ Deliveroo (Selected Restaurants)

Deliveroo half-price burgers for National Burger Day (28 May-30 May). These are the participating restaurants and menu items in the 50% off Deliveroo National Burger Day …

120
30% off Store-Wide (Excluding Equipment) @ Axil Coffee Roasters

expired 30% off Store-Wide (Excluding Equipment) @ Axil Coffee Roasters

AXILBDAY

Did you know that it's been 10 years since Axil first opened its doors? Back in 2011, following a 6-month stint of roasting out of a small roastery in Abbotsford, our directors; Dave & Zoe, …

810
[NSW, VIC, ACT, WA] Singha Lager Beer $11.99 (330 ml X 12 Pack) at ALDI (Selected Stores)

expired [NSW, VIC, ACT, WA] Singha Lager Beer $11.99 (330 ml X 12 Pack) at ALDI (Selected Stores)

An excellent international lager beer and a ripper for the price of it. Dan is currently selling 6 pack for $19.99. Use by Date: Dec 5th 2021 Good luck in finding stock in your area. 4 more cases …

602
Xiaomi Portable Handheld 120W Vacuum Cleaner (13000pa) $59 (with code) Delivered @ Kogan

expired Xiaomi Portable Handheld 120W Vacuum Cleaner (13000pa) $59 (with code) Delivered @ Kogan

OPENPAY

Edited: Kogan First members' special $54 (without code) probably expired at 4pm. However $59 with code delivered still in stock as of 6.46pm. The Xiaomi Mi Portable Handheld Vacuum Cleaner Mini …

730
LED Bulbs $2.99, Smart Bulbs $12.99, Downlights $3.99, 5M Strip $39.99, Bar Clamps $9.99 @ ALDI

expired LED Bulbs $2.99, Smart Bulbs $12.99, Downlights $3.99, 5M Strip $39.99, Bar Clamps $9.99 @ ALDI

Excerpt from the upcoming Aldi catalogue. Time to stock up on some light bulbs. Full credit to the Facebook poster. Original scan

1060

expired 40% off Site Wide (Free Shipping for Members) @ Bonds, $5 Bonus Cashback (Min Spend $15) @ ShopBack (Activate via ShopBack App)

Link to shopback challenge Seems like a decent deal when you stack them all up. Free shipping for members makes the deal even sweeter. Note: The '$ to go' amount that appears when you …

770
Sabco Stainless Steel Pegs 15pk ½ Price $4.50 (was $9) @ Woolworths

expired Sabco Stainless Steel Pegs 15pk ½ Price $4.50 (was $9) @ Woolworths

About time I made my first post! Saw these in-store and noticed they weren't mentioned in the weekly Woolies specials. Same unit price to the Aldi pegs that come and go. Made from 304 …

3771
Free A$20 Worth of BTC (after Registration with Referral & First Deposit within 90 Days) @ CoinSpot

expired Free A$20 Worth of BTC (after Registration with Referral & First Deposit within 90 Days) @ CoinSpot

CoinSpot is at it again with their Valentines Day bonus referral credit, for new users signing up and making a deposit. If you signed up last year, and held your BTC — you'll be up over …

1510
½ Price Mayver's Natural Peanut Butter Varieties 375gm $2.50 @ Coles

expired ½ Price Mayver's Natural Peanut Butter Varieties 375gm $2.50 @ Coles

It's been a while, but these are half price again from Wednesday :) Available in the Following Varieties: Mayver's Peanut Butter Smooth Mayver's Peanut Butter …

211
[VIC] $15 6 Packs and Free Delivery from All Liquorland Stores via Uber Eats (Targeted)

expired [VIC] $15 6 Packs and Free Delivery from All Liquorland Stores via Uber Eats (Targeted)

Enjoy $0 delivery fee from all Liquorland stores in Victoria until Tuesday January 26 11 p.m. Combine with a range of 6 pack beers, ciders, seltzers or pre-mixed spirits for just $15 (examples …

180

out of stock 2x Mayvers Crunchy Dark Roast Peanut Butter 375g $5 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Arguably the best flavoured Mayver's is price matching Coles at $2.50 a jar. Price alert via CamelCamelCamel. Minimum order quantity: 2 Edit: Super Natural Crunchy still available on back …

1660

expired 40% off + Free Shipping @ Bonds

It's back! 40% Off + Free Shipping at Bonds! Stock up for Christmas… Stack with 20% Cashback at ShopBack between 4pm - 8pm

1620

expired PlayStation Icons Light by Paladone $22 (Was $48) @ Big W

Brighten up the room with the Playstation Icons Light. The perfect gift for gamers, this Playstation icon light features 3 modes - standard lighting, colour phasing and music reactive. Product …

501

expired Mount Franklin Lightly Sparkling Water Plain/Flavoured 24x 250ml, $16.20 (S&S) / $18 + Del ($0 Prime/ $39 Spend) @ Amazon AU

Looks like slightly cheaper than this deal back in mid August https://www.ozbargain.com.au/node/558658

860
Apple AirPods Pro $316.31 + Delivery @ MediaForm ($300.49 with Officeworks Pricebeat)

expired Apple AirPods Pro $316.31 + Delivery @ MediaForm ($300.49 with Officeworks Pricebeat)

This is exact same deal posted here a while ago by Buy2Much on 20/07/20 I missed at that time and so was keep checking. Just noticed that it's reduced to same price again @Mediaform and this …

820

expired Bonds 40% off for 40 Hours with Free Shipping

Just saw this 40% off deal pop up. It includes Mens, Womens, Kids and Baby items. Free shipping as part of the deal or when you sign up as a Bonds Member which is also free. Can stack with an …

1720
Australian-Grown Strawberries 250g Punnet $1.30 (Catalog $1.50) @ Woolworths

expired Australian-Grown Strawberries 250g Punnet $1.30 (Catalog $1.50) @ Woolworths

Part of next week's the new catalog from 26th August, however it has been the same price (19-25 Aug period), so everyone gets an extra week to get them. Look for bright coloured firm …

710
Free: Hacktoberfest T-Shirt or Planted Tree by Opening 4 Pull Requests @ GitHub

expired Free: Hacktoberfest T-Shirt or Planted Tree by Opening 4 Pull Requests @ GitHub

Hacktoberfest is coming back again. Score a free T-shirt or a planted tree by making four pull requests on GitHub between October 1-31. Swag this year: We’re offering an alternative, …

120
20% off Skip App Orders over $20 (Max $40)

expired 20% off Skip App Orders over $20 (Max $40)

2020SAVER

Received this via email. It could be read as either a max $40 spend or a max $40 discount 🤷‍♀️ To honour this doozy of a year, we’re taking 20% off orders over $20. Code: 2020SAVER. …

270
B.box Sippy Cup (assorted colours) ½ Price $7.50 @ Woolworths - (Chemist Warehouse Price Match $6.85)

expired B.box Sippy Cup (assorted colours) ½ Price $7.50 @ Woolworths - (Chemist Warehouse Price Match $6.85)

Every little boys and girls favourite cup is on sale at Woolworths. Never seen them 1/2 price before - perhaps clearing out the 1st generation model. They appear to be available only in larger …

1681
½ Price Mayver’s Peanut Butter 375g $2.50, Harry’s Ice Cream 520ml $3, Kettle Chips 150-175g $2.32 @ Woolworths

expired ½ Price Mayver’s Peanut Butter 375g $2.50, Harry’s Ice Cream 520ml $3, Kettle Chips 150-175g $2.32 @ Woolworths

Mayver’s Peanut Butter 375g - $2.50 Mayver's Crunchy Peanut Butter 375g Mayver's Smunchy Skin On Peanut Butter 375g Mayver's Smunchy Protein Plus Hemp Seed Peanut Butter …

1630
[VIC] Order Any Burger/Salad and Get Mighty Melbourne Burger Free @ Grill'd [Free Relish Membership Required]

expired [VIC] Order Any Burger/Salad and Get Mighty Melbourne Burger Free @ Grill'd [Free Relish Membership Required]

MELBOURNE

update (thanks/credit to ynotrekab): You’ll need to be a Relish Member to redeem. Sign up below with code ‘MELBOURNE’ and once you’re in, add the Mighty and your burger choice to your …

7530
Residential Gigabit nbn Plans on FTTP and HFC 1000/50Mbps $149/mth, 250/100Mbps $209/mth, 250/25Mbps $129/mth @ Aussie Broadband

expired Residential Gigabit nbn Plans on FTTP and HFC 1000/50Mbps $149/mth, 250/100Mbps $209/mth, 250/25Mbps $129/mth @ Aussie Broadband

Live now! Website is slow right now but live chat and the sales phone number are processing orders. 1000/50 - $149 a month 250/25 - $129 a month Check what speed tier your HFC can get Source …

6520

expired 100,000 Complimentary Economy Class Return Tickets for Frontline Health Care Professionals @ Qatar Airways

Update: Allocations for 12 May have been reached. The allocation is refreshed daily at midnight Doha time (GMT+3) = 7am AEST 100,000 complimentary tickets on Qatar Airways flights. As a …

7230
$15 off Orders @ UberEATS (New & Existing Accounts)

expired $15 off Orders @ UberEATS (New & Existing Accounts)

77EATS

I saw a previous deal that had $15 off for first time ubereats and the code was 66EATS. I randomly tried 77EATS and the code worked for me even though I have many orders on my account. try it out or …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

262
Get $15 AUD Worth of Bitcoin When You Open a New Account @ BTC Markets (Limited to First 350 Accounts)

expired Get $15 AUD Worth of Bitcoin When You Open a New Account @ BTC Markets (Limited to First 350 Accounts)

BTCMUMS2020

Share with mum promo code BTCMUMS2020 and we’ll start her account with $15 AUD worth of Bitcoin. Note: Limited to the first 350 accounts opened Terms and conditions: …

1190
[NSW] Free Colombian Meal or Hamper for Needy & Elderly @ Más Tinto Stanmore

expired [NSW] Free Colombian Meal or Hamper for Needy & Elderly @ Más Tinto Stanmore

Despite revenue having fallen about 50 per cent, a Stanmore business is giving out free meals & food hampers to those in need during the coronavirus pandemic. Owners Diego Diaz & Camila …

91
1000 Morpher Tokens ($30 USD) for New Customers @ Morpher

expired 1000 Morpher Tokens ($30 USD) for New Customers @ Morpher

Morpher is offering 1000 free morpher tokens to new signups. Their service is expected to launch next month and you will be able to convert these tokens to bitcoin or stocks (Commentors suggest this …

1750
[WA] Free Vegetarian Meals for Isolated, Elderly, Medical, Disabled @ Amba Foods (Delivered Free to Suburbs in 6 Councils)

expired [WA] Free Vegetarian Meals for Isolated, Elderly, Medical, Disabled @ Amba Foods (Delivered Free to Suburbs in 6 Councils)

Stay safe :) Stirling-based Dada Bhagwan Perth foundation has joined forces with Amba Foods WA to make and deliver free vegetarian meals to people in social isolation, seniors and others …