Yakuza85 » deal and competition votes

570
[WA] Ben and Jerry's Ice Cream Slices $0.50 @ Spudshed

expired [WA] Ben and Jerry's Ice Cream Slices $0.50 @ Spudshed

Once again for WA users, spudshed morley is clearing out ben and Jerry's slices. Grabbed some last week for $1, now they're down to 50c. Definite supply at morley

23020
[PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

expired [PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games

Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …

320
3 Pack Meal Prep Reuseable Containers $2.50 (RRP $10), Instore ONLY@ Woolworths.

expired 3 Pack Meal Prep Reuseable Containers $2.50 (RRP $10), Instore ONLY@ Woolworths.

Made by Smash, varies colours, compartment size is 650ml, 200ml and 150ml, will fit in Smash Meal Prep cooler bag. BPA free, food safe, top rack dishwasher, freezer safe, microwave safe. Item …

90
2 Months Free Kayo with Specially Marked Case of VB and Carlton Draught

expired 2 Months Free Kayo with Specially Marked Case of VB and Carlton Draught

CUB is giving away 2 months of Kayo Basic to new Kayo customers who purchase a specially marked case of VB or Carlton Draught. Not much on Kayo at the moment so might want to wait a few months …

This deal is not published.
GTA V Free at Epic Games Website (Duplicate)
190
[NSW/ACT] Pepsi Max Cans 24x375mL $12.25 @ IGA

expired [NSW/ACT] Pepsi Max Cans 24x375mL $12.25 @ IGA

^Participating IGA stores in NSW/ACT only. While stocks last. Offers end 19/05

2290
Powderfinger - Regroups for 'One Night Lonely' Live Concert Broadcast 7pm AEST, 23 May @ YouTube

expired Powderfinger - Regroups for 'One Night Lonely' Live Concert Broadcast 7pm AEST, 23 May @ YouTube

Powderfinger will broadcast a brand-new gig for charity next week Australian rock heroes Powderfinger have reformed, almost ten years on from their final show. Next Saturday night, the band will …

200
SanDisk Ultra Flair USB 3.0 - 32GB $8.95, 64GB $14.95 + Delivery @ Shopping Square

expired SanDisk Ultra Flair USB 3.0 - 32GB $8.95, 64GB $14.95 + Delivery @ Shopping Square

SanDisk 32GB Ultra Flair 3.0 USB Flash Drive $8.95 + delivery SanDisk 64GB Ultra Flair 3.0 USB Flash Drive $14.95 + delivery

110
[PS4] STAR WARS™ Battlefront™ Ultimate Edition $7.55 @ PlayStation Store

expired [PS4] STAR WARS™ Battlefront™ Ultimate Edition $7.55 @ PlayStation Store

Description The STAR WARS™ Battlefront™ Ultimate Edition has everything fans need to live out their STAR WARS™ battle fantasies. In addition to the STAR WARS™ Battlefront™ Deluxe …

150
Turtle Wax Car Wash 1.25 Litre $6.49 (Was $9.99) - Ridge Ryder Head Lamp $4.99 (Was $10.99) @ Supercheap Auto

expired Turtle Wax Car Wash 1.25 Litre $6.49 (Was $9.99) - Ridge Ryder Head Lamp $4.99 (Was $10.99) @ Supercheap Auto

Turtle Wax Car Wash Exclusive - 1.25 Litre $6.49 RIDGE RYDER Ridge Ryder Head LAMP - 7 LED Something to spend ya $10 credit on!

90
$3 Large Sundae (was $3.90) @ McDonald's

expired $3 Large Sundae (was $3.90) @ McDonald's

Went to McDonalds Found the $2 McFlurry was back to $5 price Regular Sundae is $3.45 I believe Upgrade to large and it became $3 I added M&M minis for $0.70 so not a bad deal if you miss …

130
50% off MotoGP gear and merchandise + $8 Shipping (Free with over $99 spend) @ Motorsport Superstore

expired 50% off MotoGP gear and merchandise + $8 Shipping (Free with over $99 spend) @ Motorsport Superstore

MOTO50

Half price MotoGP merchandise @ Motorsport SuperStore. Plenty of MM93 and VR46 Merch and Teamwear to choose from. A similar sale to the recent F1 Teamwear sale in March 2020. Free shipping with …

980

out of stock TerraMaster F2-210 2 Bay NAS $199.99 Delivered @ TerraMaster Amazon AU

9XZJMRTE

After the success of the F4-220 I reached out to TerraMaster to see if they could offer a deal on this NAS as they have plenty of stock and they were happy to provide. It uses Realtek's RTD1296 …

1720
Large Premium Pizza, Garlic Bread & 375ml Drink $10 (Pick Up Daily Before 4pm) @ Domino’s Pizza (Selected Stores)

expired Large Premium Pizza, Garlic Bread & 375ml Drink $10 (Pick Up Daily Before 4pm) @ Domino’s Pizza (Selected Stores)

837076

Greetings everyone, got this deal in the mail today and seems like a great deal for lunch :) I have tried a large range of stores for pre-order tomorrow before 4pm, including those previously …

610
Stand Mixer $69.99 @ ALDI

expired Stand Mixer $69.99 @ ALDI

Stand Mixer $69.99 @ ALDI on 23rd May Sat. Sorry couldn't read the brand name on those pictures. 600W 5L stainless steel bowl 6 speed with pulse Tilt head Whisk, flat beater, dough hook and …

6520

expired 100,000 Complimentary Economy Class Return Tickets for Frontline Health Care Professionals @ Qatar Airways

Update: Allocations for 12 May have been reached. The allocation is refreshed daily at midnight Doha time (GMT+3) = 7am AEST 100,000 complimentary tickets on Qatar Airways flights. As a …

180
Buy 2 and save 20% off selected Lego sets, Free Delivery over $49 (Free Click & Collect) @ Myer

expired Buy 2 and save 20% off selected Lego sets, Free Delivery over $49 (Free Click & Collect) @ Myer

Myer is doing "Buy more & save" Buy 2 and save 20% off Toys, Lego, Costumes, Kids Art & Craft, Stationery and Pets. Purchased in one transaction. Not in conjunction with any other …

90
Up to 50% off Selected Items @ Helly Hansen | 50% off Sale + Standard Sale Stacks with 10% off Code | Free Shipping > $100

expired Up to 50% off Selected Items @ Helly Hansen | 50% off Sale + Standard Sale Stacks with 10% off Code | Free Shipping > $100

HELLY10

Virgin post disclaimer. Helly Hansen is a boaties staple clothing brand. Good quality clothes and some awesome wet/cold weather gear for winter. Some items have limited sizing. 50% off some …

290
[Kogan First] Kogan 68L Motion Sensor Bin $49.99 Delivered @ Kogan

expired [Kogan First] Kogan 68L Motion Sensor Bin $49.99 Delivered @ Kogan

Been looking for a new bin. Everything seems to be so overpriced - found this one for $50 and used my $500 kogan credit I got from signing up to the kogan credit card. Note that this is only for …

760
Cricketers 6 x 330ml $10, Pirate Life Acai & Passionfruit Sour 355mL x 4 $10, Angostura Bitters 200mL $17 @ Dan Murphy's Members

expired Cricketers 6 x 330ml $10, Pirate Life Acai & Passionfruit Sour 355mL x 4 $10, Angostura Bitters 200mL $17 @ Dan Murphy's Members

Prices may vary. I'm guessing $10 or $11 if your state/territory has a CDS. Some more discounts I've noted for the month of May. I've been making quite a few Old Fashioneds lately so …

130

expired WAVLINK Wi-Fi Range Extender AC1200, $50.99 Delivered @ Amazon AU

Down from $72.99 as a Lightning Deal on Amazon AU. Presumably, it's model WL-WN575A3, and it is supported by OpenWrt. Disclaimer: It's been sitting in my cart but I don't have …

87

expired PlayStation Plus USD $59.99/12 Months (~AUD $92.55) @ StackSocial

I'm guessing that this is US PS+ though it does not explicitly state so. There is a mention of being a US or Canadian citizen in the Terms though. Those who maintain US accounts may find this …

180
Breville The Toast Control 4 Slice Toaster Stainless Steel LTA670BSS $89 @ Amazon AU and Myer (Inc. Myer eBay Store)

expired Breville The Toast Control 4 Slice Toaster Stainless Steel LTA670BSS $89 @ Amazon AU and Myer (Inc. Myer eBay Store)

Breville the Toast Control 4 Slice Toaster Stainless Steel LTA670BSS Not the cheapest it’s been but saw it was popular at $10 cheaper. Available at Amazon, Myer and Myer eBay store. Myer site says …

310
[WA] 5% Discount to Emergency Services & Healthcare Workers @ Spudshed

expired [WA] 5% Discount to Emergency Services & Healthcare Workers @ Spudshed

Find it from Spudshed. 5% discount to emergency services and healthcare workers.

970
Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

expired Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

This Mother’s Day weekend, treat mum and grab a FREE Magnum Tub on any delivery order from May 9th-10th. Offer is available in valid orders via orders.redrooster.com.au or the Red Rooster …

150
Beats by Dr. Dre Powerbeats 3 $128 @ Officeworks

out of stock Beats by Dr. Dre Powerbeats 3 $128 @ Officeworks

Good price for powerbeats 3. Cheaper than beats x. Have water resistant. Good design for workouts. Better sound due to apple engineers tuning sound signature.

111
Free Choc Top with Any Popcorn Purchase (from $8.95) + Additional Choc Top with $30 Purchase @ Hoyts via Uber Eats

expired Free Choc Top with Any Popcorn Purchase (from $8.95) + Additional Choc Top with $30 Purchase @ Hoyts via Uber Eats

Just received an email from Hoyts: We’re making a selection of the HOYTS Candy Bar, available for delivery, straight to you! And the best part– with every popcorn purchase you’ll enjoy a FREE …

1370
[Android, iOS] Free 'Peppa Pig Theme Park' (was $4.49) @ Google Play & Apple App Store

expired [Android, iOS] Free 'Peppa Pig Theme Park' (was $4.49) @ Google Play & Apple App Store

Been a very popular app in the past. Stay safe, and enjoy :) iOS link thanks dealbot

1322
App Exclusive: $6 McChicken Meal + Bonus Cheeseburger @ mymacca's App (09/05/20 Only)

expired App Exclusive: $6 McChicken Meal + Bonus Cheeseburger @ mymacca's App (09/05/20 Only)

This Saturday only https://files.ozbargain.com.au/upload/22042/79470/capture.jp... Enjoy a Small McChicken Meal with lashings of our exceptional McChicken sauce and get a Bonus Cheeseburger to top …

This deal is not published.
Officeworks 5 Metre Led Strip Light $10 Clearance (Was $49.95) (Merged with insufficient quantity thread)
70

expired Optimum Nutrition Protein Stix Bars Nougat Caramel 70g 9 Pack $18.00 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Usually $34.95 Great nutrition each Protein Stix twin pack contains 20 g protein with only 5 g sugar and ~200 kcal Protein Stix single pack contains 10 g protein, under 3 g sugar and ~100 …

1910
[WA] Moza mini-mi Gimbal for smartphones - $14.80 (reduced from $148) at Officeworks Fremantle

expired [WA] Moza mini-mi Gimbal for smartphones - $14.80 (reduced from $148) at Officeworks Fremantle

Was at officeworks looking for a shredder and came across this pretty decent unit and good price. Might be nationwide this was found in Fremantle WA

170
[SUBS] Watch The K-League @ Optus Sport

expired [SUBS] Watch The K-League @ Optus Sport

https://www.smh.com.au/sport/soccer/game-on-optus-seals-dome... Hi for those who are have Optus sports, all subscribers just got a nice additional league to watch

240
20% off selected LEGO sets  + Delivery (Free Pickup from Chadstone, VIC) @ LEGOLAND

expired 20% off selected LEGO sets + Delivery (Free Pickup from Chadstone, VIC) @ LEGOLAND

Legoland discovery centre melbourne is doing 20% off selected items. Add item to cart and discount will apply automatically below good ones are sold out online it seems, however there is a high …

180
Free 600ml Soft Drink on Any Main Item Ordered Online or Takeaway in May (Must Show Voucher) @ Nando's

expired Free 600ml Soft Drink on Any Main Item Ordered Online or Takeaway in May (Must Show Voucher) @ Nando's

Grab a FREE 600ml soft drink on us the next time you order any main item online or to takeaway in May. Cheers to that!

161

expired Car Solar Wireless Tyre Pressure Monitoring System (AU Stock) US $23.62 (~ AU $37.26) Shipped @ AliExpress

Alternatively, for ~AU $0.11 extra if the other one sold out Look to be exactly the same one as this deal which just sold out and sounds like a useful tools to have Shipped from AU warehouse with …

700
[QLD, WA, VIC] Free Quarter Chicken Meal for Frontline Workers @ Red Rooster (Selected Stores)

expired [QLD, WA, VIC] Free Quarter Chicken Meal for Frontline Workers @ Red Rooster (Selected Stores)

From today, Red rooster will be giving away a Free Quarter Chicken Meal for Essential Health workers/ Front Liners who served and protected many Australians during the Covid 19 crisis. Health Workers …

240

expired Canesten Antibacterial and Antifungal Hygiene Laundry Rinse Lemon 1L $6.07(S&S) @ Amazon (+Shipping/$0 Prime/Spend $39 Shipped)

Cheaper than previous price which was $6.74 (S&S) Lemon scented Laundry additive Eliminates 99.9% of Germs Elimates 99.9% Germs. Eliminates Bacteria and Fungi from your washing Helps prevent …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

1620
[NSW, SA, VIC, WA, QLD] WD 1TB My Passport External SSD - USB Type C - $139 Pickup @ Officeworks

expired [NSW, SA, VIC, WA, QLD] WD 1TB My Passport External SSD - USB Type C - $139 Pickup @ Officeworks

Officeworks has dropped the price of these again, might be able to snag one if you weren't swayed by the Amazon/JB pricing. Seems to be clearance stock with pickup only but looks to be a few …

130

expired Bega Peanut Butter 780g - Crunchy $5.91 ($5.32 S&S), Smooth $6.50 ($5.85 S&S) + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Bega Smooth Crunchy Butter https://www.amazon.com.au/Bega-Smooth-Roast-Peanut-Butter/dp... Bega Smooth Peanut Butter https://www.amazon.com.au/dp/B07JYZVJSB Source of protein, vitamin B3 & …

190
Seagate 512GB SSD Game Drive Xbox $129 + Delivery (Free C&C) @ JB Hi-Fi

expired Seagate 512GB SSD Game Drive Xbox $129 + Delivery (Free C&C) @ JB Hi-Fi

512GB expansion SSD for xbox … or anything that can use a USB SSD, I use mine on my PC. Details from JB Site below: Overview Built for elite gamers, the Seagate® Game Drive for Xbox SSD uses …

12525
[NSW] Pace Farm Cage Eggs 12pk/500g $0.99 @ Costco Marsden Park (Membership Required)

out of stock [NSW] Pace Farm Cage Eggs 12pk/500g $0.99 @ Costco Marsden Park (Membership Required)

Saw this as Costco Marsden Park, maybe available in other locations.

110
[NSW] Free Brisket Box for Bartenders (RSA required) @ Fortuante Son, Enmore

expired [NSW] Free Brisket Box for Bartenders (RSA required) @ Fortuante Son, Enmore

A great gesture by the owners of a decent bar in Enmore for fellow bartenders.

100
Mirabella Genio Colour Changing Wi-Fi Smart LED Light Strip 3x 3m $89.99 @ Costco (Membership Required)

expired Mirabella Genio Colour Changing Wi-Fi Smart LED Light Strip 3x 3m $89.99 @ Costco (Membership Required)

Found this at Costco Marsden park NSW last night - 3 x 3m Mirabella Genio smart led strip RGBW with power adapter and switch, works with Alexa and Google home. Seems to be standard price at Costco, …

This deal is not published.
2001 Gulfstream G-200 Aircraft ($3,250,000) Save $375,000 (Joke post)
1380
½ Price Mr Chen’s Bulk Size Family Packs 904g-1kg $10.50 @ Woolworths

expired ½ Price Mr Chen’s Bulk Size Family Packs 904g-1kg $10.50 @ Woolworths

Mr Chen’s Bulk Size Family Packs 904g-1 kg - $10.50 Mr Chen's Prawn Hargow 1kg Mr Chen's Seafood Selection 904g Mr Chen's Pork & Prawn Dumplings 1kg Mr Chen's …

130
Free Virtual Parties (Adults and Kids) - Holey Moley, Strike Bowling & Archie Bros + Free Voucher

expired Free Virtual Parties (Adults and Kids) - Holey Moley, Strike Bowling & Archie Bros + Free Voucher

Strike Bowling, Holey Moley & Archie Bros are offering Free Virtual parties during the lockdown Book an online party on their websites (links below) and they will supply the host, the games, …

290
Seagate 1TB Fast SSD 2.5" USB-C External Portable SSD STCM1000400 for $199 + Delivery @ Computer Alliance

expired Seagate 1TB Fast SSD 2.5" USB-C External Portable SSD STCM1000400 for $199 + Delivery @ Computer Alliance

Looks like a good price for 1tb SSD. Expensive at other places

2490
15 Free Pokémon Movies + 100s of TV Episodes @ Pokémon TV

Long Running 15 Free Pokémon Movies + 100s of TV Episodes @ Pokémon TV

Greetings everyone, time to relive the childhood memories, Pokemon TV has added a range of movies and TV shows over the past few weeks to assist those in isolation :) 2 extra movies will be added …