WoodYouLikeSomeCash » deal and competition votes
160
Email. Offer expires 28/05/2020. Receive a free 600ml bottled Coca-Cola, Coke No Sugar, Sprite or Mount Franklin water with any Parmi Classics sub purchase including Chicken Parmi Sub, Chicken …
3261
Telstra's Extra Small data plan is normally $15/month, but connections during '7 Day Frenzy' get $10/month off for the first 12 months. No lock-in contract, so you can cancel any time …
880
Vodafone is currently running a 6 days promotion for their Endless Data SIM only mobile plans. For $35/month ($40/month plan with $5 off each month for 12 months), you get Unlimited calls & …
140
CLICKFRENZY
Here's adidas' Click Frenzy offer. 40% off assorted collection until 21 May with coupon code CLICKFRENZY. Free shipping when you spend $100 or more. Terms and conditions here. There are …
123
Just saw this is back in stock at Amazon, $2 more expensive than last month but still good value. Unfortunately no subscribe and save available at the moment.
2160
another set of Bonds..BONDS MENS LOGO LOW CUT SOCKS 5 PACK..seems good deal.dollar each. https://www.bonds.com.au/bonds-mens-logo-low-cut-socks-5-pac... Free shipping. Another 6 socks …
920
Jetstar has started a ticket sale for flights from Oct-Dec (roughly). I've gone through all dates for a few city pairs below - but there are a LOT more, it just takes time to do each …
3060
Mod 17/3/22 - See Forum Post to continue discussion. OP UPDATE 6 - 19/11/2021 - Just got off the phone with Origin Retention's Team. It looks like the number in my post randomly goes to …
1002
GYGDELIVERYGYGFREEDELMACCASWIN
Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …
This deal is not published.
Free Delivery (Min Spend $25) @ McDonald’s via Uber Eats
(Duplicate)
2090
Winner of several awards at the 42nd Academy Awards including 'Best Picture'. Rotten Tomatoes Critic Score: 99%, Audience Score: 90% Reduced from $19.99. Ki-taek's family of four is …
23020
Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …
- 589
- Gaming
- Freebie
- 11 Jun 2020
9
1380
Greetings everyone, was on the hunt for some Vegemite and spotted that Big W have it on sale currently for a great price! Seems to be plenty of stock around nationally. Amazon is now the same …
880
$4 cheaper than previous Officeworks deal which was pretty popular https://www.ozbargain.com.au/node/529652. If you have luck finding any stock instore at Officeworks you potentially can get a price …
137
641
Normally $6.20. Woolies has it on special for $4.50 Made with Australian Spring Water In a range of pack formats to meet your hydration needs Perfect for travelling or for your next holiday …
This deal is not published.
Free $20 E-Gift Voucher + 1,000 Qoin for Downloading Qoin App and Completing Registration Form @ Qoin (Businesses Only)
1020
3500X-2080S-MAY3600-2080S-MAY3700X-2080S-MAY
Hi all, This is our lowest possible pricing for Ryzen 5 and Ryzen 7 / RTX 2080 Super combos at current currency exchange and supplier pricing (current retail price for 2080 Super is $1199 at …
800
Similar to the Free Registrations for Microsoft Build 2020 deal. Click here to Enrol yourself as a developer if you do not already have a Developer account. Annual fees for this Developer program …
980
After posting the Optus deal I noticed this family deal from Aldi wasn't not posted on here. With this plan you pay $80 and get 4 sims with unlimited calls and sms and 72gb to be shared. Unused …
811
Could be useful for heavy users or if have no fixed internet. Month to month. Optus sport and 1 year Apple Music (terms and conditions apply). The 4 sims share the data. It works out $37.50 a sim, …
5815
Don't get in line, go online! To thank everyone for their early support of CheaperDelivered.com (and water aid) and to commemorate the great toilet paper shortage of 2020 we be giving away 1 …
1290
Just saw this banner on the JB Hi-Fi homepage. Coupon will be emailed within 7-10 working days of gift card purchase. Limit of one $10 coupon per transaction. $100 gift cards purchased …
1420
Another freebie from Square Enix. Note - has IAP. Challenge all-new turn-based logic puzzles and solve a futuristic mystery in Deus Ex GO, the next tactical board game from the makers of the …
3690
Greetings everyone, seems like a great deal on this game from the Play Store :) Challenge all-new turn-based logic puzzles and solve a futuristic mystery in Deus Ex GO, the next tactical board …
2130
https://www.engadget.com/microsoft-build-2020-free-230841389... In addition to hosting its annual Build developer conference online, Microsoft now plans to make the event free to attend. On …
1258
Join eBay Plus for $49 and get a $50 ebay digital gift card. This is showing on rotation on the home page banner, and also a small ad in the middle of the ebay plus page. Banner I don't believe …
- 199
- Other
- 31 May 2020 4:37pm
625
It appears that this popular deal is back. Advert. FAQ: Who is eligible for this promotion? Customers who have an eBay account with a registration address in Australia and who have a relevant …
- 64
- Other
- 1 Jun 2020 9:55pm
680
Seems like a reasonable deal if you're only after 5.1 Description 5.1-channel AV receiver featuring MusicCast Surround capability and exceptional ease of use for enhanced entertainment …
2800
Just opened the maccas app & found this deal. Spend $10 or more & get 20% off your order. Expires in 5 days. Not sure if targeted?
1891
The Good Guys - Terms and Conditions To be eligible to purchase a selected iPhone SE 64GB for $199 between 24th April – 30th April 2020 (Promotional Date) customers must: Port in to …
650
Everything is back to normal… Toilet Paper iCare Toliet Paper.. the good stuff and good for the environment. Still saying limit 1.
1170
As reported - Between April 29 and May 6, you’ll be able to access Turf War, Ranked Battle, and even Salmon Run – you’ll even be playing against people who have the full game. So if …
6650
Quilton 3 Ply Toilet Tissue (180 Sheets Per Roll, 11x10cm), Pack of 36 $14 + Shipping @ Amazon Free with Prime It’s Back online again TP 1 per member
250
MODALV1
I was browsing eBay and this popped up at the top of the screen - ironically on an account that I've signed up to eBay Plus already (via the $1 offer). Seems like free money? Says you've …
4982
OZBSB2
Hi everyone, this week we're celebrating our 2nd birthday in Australia! So much has happened in these 2 years and we'd like to thank everyone for their support along the way. We're …
7
518
Artists Choice 100% Pure Isopropyl Alcohol (Rubbing Alcohol) (5 Litre) - (1 x 5L) https://lebeauty.com.au/products/artists-choice-100-percent-... Artists Choice 100% Pure Isopropyl Alcohol (Rubbing …
6560
Reposting previous deals as this is a great reminder for those unaware you can access YouTube premium at a fraction of the price it normally costs. Will come in handy right now with most of us at …
4500
We have received our first quarterly $10 reward from IKEA today. The coupon codes (QR and online: IF84Pk7u) are the same for both accounts (see screenshot attached). To shop in store you have to scan …
3820
Responding to teachers’ requests for access to documentaries https://media.netflix.com/en/company-blog/free-educational-d... For many years, Netflix has allowed teachers to screen …
5
This deal is not published.
[VIC] Free Message to Say Thank You on Bourke St Billboard @ Telstra (Requested by OP)
220
Mailchimp currently are offering a free Domain Name up to the value of $25 USD for five years if the domain name you choose is more you just have to pay the difference. You're required to build …
3010
Cheapest paper around 99c for 200 sheets. That’s $2.50 for 500 sheets - and no one does that price. Plenty in Auburn (end cap not normal paper area)
730
$240.29 after 3.5% cashback at Cashrewards 6.4" Super AMOLED 2340 x 1080 (FHD+) with water drop notch Rear Finger Print NFC B28 USB-C 4,000 mAh Battery RAM 3GB Storage 32GB MicroSD (Up to …
1340
Greetings everyone, today Apple have released some free TV series to assist those in isolation :) No subscription is required, just open up the Apple TV apple on your supported device and stream …
1340
Greetings everyone, The Good Guys are running a promotion where you can get the Samsung Galaxy S10 128gb for $149 Upfront when you take out a $65 Per Month 60gb Telstra Plan. Consider that the plan …
7451
Edit - For those that have issues with the Creator Club membership, you can apply the promo code FAM30 to get an extra 30% off everything on top of the up to 50% off outlet. Nice deal for adidas. …
![Jetstar O/W Domestic: SYD <> MEL (AVV) $34, SYD <> Gcoast $55, MEL <> ADL $41 and Many More [Oct-Dec] @ BeatThatFlight](https://files.ozbargain.com.au/n/86/538186.jpg?h=43d052b4)
![[QLD] Solar Boost Plan 20c FIT @ Origin Energy](https://files.ozbargain.com.au/n/80/538080.jpg?h=461446d1)
![[PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games](https://files.ozbargain.com.au/n/16/537516.jpg?h=80034580)
![[iOS] Free - Deus Ex GO | Adblock Pro for Safari | 4x 8bitwar Apps @ Apple App Store](https://files.delvu.com/defaults/default.jpg?v=1)
![[Android] Free - Deus Ex GO (Was $9.99) @ Google Play Store](https://files.ozbargain.com.au/n/60/534660.jpg?h=c42ab339)
![iPhone SE (2020) 64GB $199 with Telstra 12mth $65 60GB Plan @ JB Hi-Fi & The Good Guys [Port-In Customers, In-Store Only]](https://files.ozbargain.com.au/n/37/533037.jpg?h=5834a2b5)
![[NSW] ½ Price iCare Toilet Paper 3 Ply 8 Rolls $3.50 @ Woolworths, Double Bay](https://files.ozbargain.com.au/n/27/533127.jpg?h=d74f624b)
![[Switch] Splatoon 2 Special Demo 2020 - Free to Play for 1 Week for Nintendo Switch Online Subscribers (30/4 - 6/5)](https://files.ozbargain.com.au/n/34/532634.jpg?h=565250eb)
![[Pre Order] 100% Pure Isopropyl Alcohol (Rubbing Alcohol) 5L/10L/20L- $69.95/ $132.95/ $237.95 Shipped @ Le Beauty](https://files.ozbargain.com.au/n/83/531983.jpg?h=910fa586)
