sparki » deal and competition votes

6520

expired 100,000 Complimentary Economy Class Return Tickets for Frontline Health Care Professionals @ Qatar Airways

Update: Allocations for 12 May have been reached. The allocation is refreshed daily at midnight Doha time (GMT+3) = 7am AEST 100,000 complimentary tickets on Qatar Airways flights. As a …

40
Savoury Box 18 for $40.50 ($2.25ea) + Delivery or 120 for $150 ($1.25ea) (Free Freight over $50) @ Snowy Mountains Cookies

expired Savoury Box 18 for $40.50 ($2.25ea) + Delivery or 120 for $150 ($1.25ea) (Free Freight over $50) @ Snowy Mountains Cookies

This Savoury Snack Pack is a combination of our Turmeric and Pepper Snaps (21g), a Roasted Cauliflower and Yogurt Dip (25g) and Honey and Soy Multigrain Crisps (18g). Our Savoury Snack Packs are …

2580
[PC] Free - Delores: A Thimbleweed Park Mini-Adventure @ Steam & Epic

Long Running [PC] Free - Delores: A Thimbleweed Park Mini-Adventure @ Steam & Epic

A freebie released today from the developers of Thimbleweed Park “as a thank you to our fans, we are releasing it for free as something you can have fun with in these odd times.“ Also available …

1600

expired [Kindle] $0 Takeout Cookbooks - Japanese, Thai, Lebanese, Chinese @ Amazon AU/US

Free at the time of posting. ebook US link AU link The Simple Art of Japanese Cooking: Everything You Need in a Japanese Cookbook US AU Japanese Takeout Cookbook …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

60
[PC] DRM Free: Little Nightmares $6.79/Absolver $8.50/My friend Pedro $17.39 (Expired) Firewatch $4.99 at GOG

expired [PC] DRM Free: Little Nightmares $6.79/Absolver $8.50/My friend Pedro $17.39 (Expired) Firewatch $4.99 at GOG

Historical low prices for these games (according to ITAD). Little Nightmares: https://www.gog.com/game/little_nightmares Absolver: https://www.gog.com/game/absolver My friend Pedro: …

160
[NSW, VIC] Free Delivery for Orders over $30 via Doordash

expired [NSW, VIC] Free Delivery for Orders over $30 via Doordash

Just saw this deal when logging into the doordash app - states free delivery for orders over $30. Seemed to cover most of the restaurants I could see on the landing page. Am in NSW. Not sure if it …

1650
[PC] Free - Showdown Bandit (Was $1.50) @ Steam

expired [PC] Free - Showdown Bandit (Was $1.50) @ Steam

Another free very positively rated game to keep from Steam. Something unnatural is stirring on the abandoned sets of the once popular kids puppet show, Showdown Bandit. Play as the awakened …

26
2x Face Cleansing Bars $25 Delivered @ Australia Secret

expired 2x Face Cleansing Bars $25 Delivered @ Australia Secret

MUMSTHEONE

What is it? Natural face cleanser in solid block form, giving you more in the long run and no more going to landfill. Made in Australia with main ingredients coconut milk and shea butter. Vegan, …

1330

expired [Kindle, eBook] $0 eBooks (Hourly History, Aquaponics, CBT, C++, Yoga, Mother) @ Amazon AU/US

A selection of ebooks free at the time of posting. ebook US link AU link Hydroponic Aquaponic and Raised Bed Gardening 3 in 1: How to design and Build a Perfect System Hydroponic …

1410

expired [eBook] Free: "Zen For Beginners" $0 @ Amazon

Only a short eBook but I found it very helpful in isolation and encouraged me to learn more about meditation. Zen is a branch of Buddhism that focuses mainly on meditation and teaches you ways to …

19314
Free Online Tour of Ghibli Museum (Japan) @ YouTube

expired Free Online Tour of Ghibli Museum (Japan) @ YouTube

There are currently three short videos (you could probably finish watching them in the same time as reading this description) with more possibly in coming weeks. Photography and videos are prohibited …

1010

expired $50 off $199 Spend on Contacts + Free Delivery @ Specsavers

CRBDAY

Looks like another Cashrewards birthday deal. Cashback for New Customers - Contact Lenses 8% Cashback for Existing Customers - Contact Lenses 4.2%

267
Extra 40% Off Sale Prices for Fashion, Shoes and Accessories @ David Jones (Free Delivery over $50)

expired Extra 40% Off Sale Prices for Fashion, Shoes and Accessories @ David Jones (Free Delivery over $50)

It's that same deal again. DJ are still trying to move stock. No coupon required. Expires end of tomorrow.

820
Up to 50% off  Vegan Meaty Mixes (e.g. 10 Packs for $40 (Save $40)) + Free Delivery @ Unreal Co.

expired Up to 50% off Vegan Meaty Mixes (e.g. 10 Packs for $40 (Save $40)) + Free Delivery @ Unreal Co.

Bought the chicken style at woolies a couple times and really enjoyed it. Just add water, mix and cook, From their website: Buy Meaty Mix in bulk at heavily discounted prices with free shipping …

730

expired [Prime, eBook] Amazon First Reads - Early Access + Choose One of The Eight Kindle Books for May 2020

Amazon First Reads is a program that offers customers early access to new books across popular genres from Amazon Publishing. Every month customers can choose one of the six Kindle books selected by …

3055

expired [Windows 10] PDF Conversion Tool - Free (Was $19.99) @ Microsoft Store

PDF Conversion Tool allows you to easily and quickly convert almost any file into PDF format and back. Easily converts PDF file to Microsoft Word format (doc, docx) and to almost any images format …

1930

expired [Kindle] $0 eBooks (Korean, Cooking, Fairy Tales, Children's, Riddles, Indian Gods, Drawing, Game of Thrones, Guitar) @ Amazon

A selection of ebooks free at the time of posting. ebook US link AU link Korean Takeout Cookbook: Favorite Korean Takeout Recipes to Make at Home US AU The Sun and the …

900
Moccona Ice Brew Coffee 390ml $0.10 @ Reject Shop

expired Moccona Ice Brew Coffee 390ml $0.10 @ Reject Shop

Two flavor normal and coconut, l believe most of them expire soon about 10 days or so. U can return them for 10c in NSW literally get it for free https://returnandearn.org.au

1230

expired [Switch] Ring Fit Adventure - $124.95 Delivered @ Amazon AU

Ring Fit Adventure back in stock at Amazon. Will probably go quick. Credit to @nubix

120
Earth Choice Multi Purpose Spray & Clean 600ml $2.69 + Delivery ($0 with $50 Spend /C&C /In-Store) @ Chemist Warehouse

expired Earth Choice Multi Purpose Spray & Clean 600ml $2.69 + Delivery ($0 with $50 Spend /C&C /In-Store) @ Chemist Warehouse

Coles $3.20 Woolworths $3.20 My Chemist $2.99 Free C&C from Chemist Warehouse or spend $50 for free delivery. While stocks last.

1040
Free Delivery with Orders over $25 at Hungry Jack's via Menulog

expired Free Delivery with Orders over $25 at Hungry Jack's via Menulog

HJSWEEKEND

Free delivery from Hungry Jacks this weekend via Menulog with code HJSWEEKEND From participating stores. Ends 3/5 @11:59pm T&C from email *$5.95 delivery voucher is only valid with orders …

This deal is not published.
[Switch] Free: Nintendo Switch Online 7 Day Trial Reset @ Nintendo (Even if Used Previously) (Not available to Australia)
1520

expired [eBook] Free: "The Best Pasta Cookbook: 100 Classic Pasta Recipes" $0 @ Amazon

There are so many recipes in this book that it doesn't matter if you are a vegetarian or a meat enthusiast, there's certain to be recipes that appeal to you, whether it's a salad …

1370
Free 10-Day "We Are One" Global Film Festival @ YouTube

expired Free 10-Day "We Are One" Global Film Festival @ YouTube

Stay safe, and enjoy :) In light of closures surrounding the coronavirus pandemic, YouTube announced on Monday an exclusive global 10-day "We Are One" film festival featuring movies …

1030
Free - 1.9 Million Images & 4 Million Items Now Available to View/Download @ British Museum

Long Running Free - 1.9 Million Images & 4 Million Items Now Available to View/Download @ British Museum

Source - The British Museum has revamped its online collections database, making over 1.9 million photos of its collection available for free online under a Creative Commons license. Under …

1000
$5 off When You Order from Independent Asian Restaurants @ Menulog (4pm-6pm AEST Only)

expired $5 off When You Order from Independent Asian Restaurants @ Menulog (4pm-6pm AEST Only)

SENDNOODS

No Minimum Order - Pickup or Delivery From 4 to 6pm on Tuesday 28 April 2020, Menulog are offering $5 off your order on Asian Food for their Happy Hour promotion! It’s valid for the following …

1766
$30 Menulog Voucher for Essential Workers, Battlers, Elderly and Those in Need @ Menulog

expired $30 Menulog Voucher for Essential Workers, Battlers, Elderly and Those in Need @ Menulog

Greetings everyone, seems like a generous offer from Menulog to support those in these difficult times :) Amid the difficulties many Australians are facing as a result of the Coronavirus …

350

expired [eBook] Free: The Confectioner’s Guild (Was $6.99) @ Amazon AU, Apple, Google & Kobo

An enchanting fantasy that’s first in a series: Wren’s sweet treats aren’t just delicious — they’re magical. But when someone poisons one of her cupcakes to frame her for murder, she must …

1520
40% off @ Blunt Umbrellas ($10 Standard Shipping)

expired 40% off @ Blunt Umbrellas ($10 Standard Shipping)

cheeky40

Originally found on choicecheapies here: https://www.cheapies.nz/node/23300 Seems like it works on the .com.au store too though! For some reason their domain seems to have changed from …

2282
Oomph Instant Hand Sanitiser 500ml $6.95 @ Bunnings

expired Oomph Instant Hand Sanitiser 500ml $6.95 @ Bunnings

Available at the counter. Couldn’t see it listed online. Was advised that stock had just come in today. 500ml @ $6.95 Receipt Back of bottle pic: Ingredients: Alcohol, Aqua, PEG-40 …

2800
McDonald’s- Spend $10+ & Get 20% Off Your Order via Mymacca’s app

expired McDonald’s- Spend $10+ & Get 20% Off Your Order via Mymacca’s app

Just opened the maccas app & found this deal. Spend $10 or more & get 20% off your order. Expires in 5 days. Not sure if targeted?

2410

expired [eBook] 45 Free eBooks for Children @ Amazon

Some nice books to keep the kids busy. All free at time of posting. Enjoy :) us au 100+ Knock Knock Jokes us au All Tucked In on Sesame Street us au An Evening With Grandpa us au Babaroo …

1290

expired [Kindle, eBook] Free - (Microsoft) Excel Companion + 4 Quotes/Jokes eBooks @ Amazon AU/US

Free at the time of posting. ebook US link AU link EXCEL: EXCEL COMPANION (WITH 220 SCREENSHOTS + A PRINTABLE 4 PAGE CHEAT SHEET) (EXCEL 2016 FOR BEGINNERS, EXCEL 2016 FOR DUMMIES, …

This deal is not published.
[VIC] 70% Alcohol - Hand Sanitiser 500ml $10 + Delivery (Free over $100 in Melbourne CBD/Pickup) @ VMPS, Sunshine West (Sockpuppeting)
1800

expired [eBook] Free: "1,000 Random Facts Everyone Should Know" $0 @ Amazon

Have you ever had that moment when you are in the middle of a conversation and suddenly the room becomes quiet and nobody knows how to move the discussion forward? Of course you do. Haven’t we …

121
[VIC] Sunrise Free Range Eggs 500g $1.99 Per Dozen @ Lalor No1 Fruit Market

expired [VIC] Sunrise Free Range Eggs 500g $1.99 Per Dozen @ Lalor No1 Fruit Market

I think a bargain $1.99 for 12 eggs but 500gm 48 eggs for $7.96 Address Shop 1 Peter lalor walk Lalor 3075 vic

44
ProDefend 72% Alcohol Gel Based Hand Sanitiser with Aloe 500ml $9.9 + Shipping (Free Shipping over $55) @ Miratra

expired ProDefend 72% Alcohol Gel Based Hand Sanitiser with Aloe 500ml $9.9 + Shipping (Free Shipping over $55) @ Miratra

Composition: 75% Ethyl Alcohol 19% Water 4% Glycerine 0.5% Carbomer <1% Aloe Extract MSDS & CE can be viewed from our site Made in China

2990

expired [Kindle] Free - 4 Japanese/Korean Cooking eBooks (Expired) | Beatrix Potter Ultimate Collection - 22 Books | Cyberstorm @ Amazon

Edit - adding another two ebooks found on HUKD and Slickdeals - ebook US link AU link BEATRIX POTTER Ultimate Collection - 22 Books With Complete Original Illustrations: The Tale …

1650

expired [eBook] Free: The Vegetarian Cookbook: 1,000 Easy & Delicious Vegetarian Recipes $0 @ Amazon

Do you want to live a healthier lifestyle? Have more energy throughout the day? And start feeling vibrant and more confident about yourself? This Vegetarian Cookbook Will Help You: •Start …

1532
[NSW] Free NSW Driver's Licence & Car Registration for Pensioners

Long Running [NSW] Free NSW Driver's Licence & Car Registration for Pensioners

Eligible pensioners receive the following products free of charge: Registration Costs Licences Driving tests Riding skills test Heavy Vehicle Competency Based Assessment (CBA) …

160
[NSW] Free Delivery on First 3 Orders of $80+ @ Harris Farm Markets

expired [NSW] Free Delivery on First 3 Orders of $80+ @ Harris Farm Markets

Perfect for isolation shopping- Free Delivery On Your First 3 Orders over $80. Shop Online at Harris Farm Markets and receive FREE DELIVERY ON YOUR FIRST 3 ORDERS OVER $80*! *To be eligible for …

12518
[SUBS] Disney Pixar Animated Film: "Onward" Available on Disney Plus (Subscription Required)

expired [SUBS] Disney Pixar Animated Film: "Onward" Available on Disney Plus (Subscription Required)

$6.99 to rent on all other services (as it's a new release). Disney's "Onward" Movie Free on Disney+. Yes I know it's a subscription service but obtain a free trial. I …

1690

expired [Kindle] Free - 4 Mastering Excel eBooks @ Amazon AU/US

A couple of ebooks on Microsoft Excel that looks to be free for the first time. Free at the time of posting - please check carefully before you download! ebook US link AU link …

2352
Free - Michael Moore Presents: Planet of The Humans | Full Documentary @ YouTube

expired Free - Michael Moore Presents: Planet of The Humans | Full Documentary @ YouTube

From Michael Moore’s Twitter: https://twitter.com/mmflint/status/1252583111621144576?s=21 Free - Michael Moore Presents: Planet of The Humans | Full Documentary @ YouTube

1210
[PC] Free: Influent with French, Korean, Italian included (Was $14.50) + 50% off other DLC - Steam

expired [PC] Free: Influent with French, Korean, Italian included (Was $14.50) + 50% off other DLC - Steam

This language learning game cost money but is now free. Languages included in free version are Italian, French, and Korean. Additional languages can be bought as DLC. Game is rated very positive in …

2290

expired [Kindle] Free - 59 eBooks (Amazon Classics & Disney) @ Amazon AU/US

These classics became free at the end of March. Additional source. Free at the time of posting - please check carefully before you buy! Amazon Classics ebook US link AU link A …

98

expired Kleenex Soft Jumbo Toilet Rolls, 300m/Roll, Case of 6 Rolls $70.96 Delivered @ Amazon AU

Kleenex 5749 Kleenex Soft Jumbo Toilet Rolls (300 metres per roll), Pack of 6. 4.8kg of toilet paper $70.96 with free shipping. Limit of 5 per customer (this means you can order 9 kilometres of …

102
I-Fresh 500ml >65% Alcohol Hand Sanitiser $15 + Delivery or Free Pickup (Darlinghust/N. Bay) @ The Colonial Restaurant

expired I-Fresh 500ml >65% Alcohol Hand Sanitiser $15 + Delivery or Free Pickup (Darlinghust/N. Bay) @ The Colonial Restaurant

COVID19

Here's a Hand Sanitiser deal for anyone looking for some stock for home and work. If you use promo code COVID19 you get $4.95 OFF the retail price of $19.95 (So you pay $15) You can apply the …

100
Happy Happy Soy Boy: Soy Milk 1L $3 + $15 Delivery (Free Delivery over $200) or Free Pickup (Braybrook, VIC) @ JFC

expired Happy Happy Soy Boy: Soy Milk 1L $3 + $15 Delivery (Free Delivery over $200) or Free Pickup (Braybrook, VIC) @ JFC

Happy Happy Soy Boy for $3 1L. I haven't seen in in stores before but Broadsheet says the following Melb. cafes use it: Seven Seeds Hardware Société Lobbs Smith & Deli Bonnie Coffee …