llamarino » deal and competition votes
2090
A highly rated Dr. Seuss app your young ones. Apple App store Join Yertle the Turtle, king of the pond, in this interactive book app as he commands the other turtles to stack themselves beneath …
- 17
- Mobile
- Freebie
- 31 May 2020 11:40pm
550
Long-lasting and uniform warmth thanks to the long thermal inertia of the oil inside the unit – recommended for rooms up to 35m3 - 7 Year Warranty on all De’Longhi Oil Column Heaters XXL Extra …
800
Store bulk rice, flour or grains in this large Rice Case which has a 12 litre capacity and features an angled flip open hatch opening for easy access. It comes complete with a cup for scooping …
16040
The next freebie from the Epic Store is here. This time it is Sid Meier's Civilization VI. Enjoy! Note: The Platinum Upgrade can be bought in the current sale with the $15 off coupon for …
- 171
- Gaming
- Freebie
- 29 May 2020 1:00am
550
WOOLIES10
*Offer valid from 00.01 AEST 22.5.2020 until 23.59 AEST 26.5.2020 with min. spend of $150 on Pick up or Delivery at woolworths.com.au in a single transaction. Discount will be activated when voucher …
1630
Enjoy :) Chobani Greek Yoghurt Limited Edition 170g Chobani Low Fat Lemon Yoghurt 170g Chobani No Fat Raspberry Yoghurt 170g Chobani Low Fat Mango Yoghurt 170g Chobani Low Fat Passionfruit Yoghurt …
1010
Long time lurker, first time poster :) Right on time for Mother's Day. 50% off Tefal fry pans, saute pans and woks, ends tomorrow. Link will bring you to "Tefal pan" keyword …
970
This Mother’s Day weekend, treat mum and grab a FREE Magnum Tub on any delivery order from May 9th-10th. Offer is available in valid orders via orders.redrooster.com.au or the Red Rooster …
620
Nintendo Switch Pro Controller back on sale at Amazon AU: To get it for $78 ($1 below Amazon price) and free delivery without Prime, click on "7 new from $78.00" and change seller to …
15214
Back in stock! I’d admit it’s not a deal per se. But I’m sure people will be keen to buy even at rrp given market prices and limited stock. Update: 8/5 Back in stock, (thanks ColstonAUS)
- 147
- Gaming
- 12 May 2020 11:41am
1322
This Saturday only https://files.ozbargain.com.au/upload/22042/79470/capture.jp... Enjoy a Small McChicken Meal with lashings of our exceptional McChicken sauce and get a Bonus Cheeseburger to top …
1002
GYGDELIVERYGYGFREEDELMACCASWIN
Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …
740
Bought one from JB Hurstville this afternoon. Called them and they said they couldn't hold one for me. Came to pick up one. Also picked up Animal Crossing for $69 from JB. There were about …
2393
KFC4MUM
KFC is at it again and offering an unexpected treat this coming weekend. To celebrate Mother’s Day (it’s this Sunday for anyone who isn’t yet organised), KFC is discounting their entire menu …
240
Long the gold standard in soy milk, Bonsoy have now turned their attention now to almond milk. Usually $4.99, $2 is an absolute bargain for those who drink the stuff. Personally I don't like …
840
QubicGames have been simultaneously celebrating their 16th birthday as well as raising funds for COVID-19 relief. For the next few days, Party Treats is being offered for free to owners of Geki …
3220
Edit - this deal is now live. All three games are now free! Free from May 1-5 if you missed it previously. If the page comes up blank then you may need to load it on a pc according to some users …
3690
Greetings everyone, seems like a great deal on this game from the Play Store :) Challenge all-new turn-based logic puzzles and solve a futuristic mystery in Deus Ex GO, the next tactical board …
640
Earn 600 Bonus Points (Worth $3) on $30 Ultimate Range for Kids, Teens & Students Earn 1000 Bonus Points (Worth $5) on $50 Ultimate Range for Kids, Teens, Students, Him & Home Earn 2000 …
1190
Not the cheapest all time deal but not too bad either. My first plunge into Edifier, I hope this helps out others too.
1090
PDIGI20
Just noticed this deal while browsing the app. Looks like a good discount, up to a maximum discount of $1000 and 5 uses. Store link: https://www.ebay.com.au/str/digidirectstore Conditions. The …
1766
Greetings everyone, seems like a generous offer from Menulog to support those in these difficult times :) Amid the difficulties many Australians are facing as a result of the Coronavirus …
760
Now that the panic has died down this deal is available again for new customers. Cancel anytime within 30 days. Subscription Prices: Midweek Delivery (Tuesday, Wednesday, Thursday) - $15/Month …
1880
Noticed this on the Xbox App last night, Season 1 - 12 for $9.99. Seasons 1 - 11 are on Netflix, but for those of you that can't wait for Season 12 to pop up not a bad deal. You've only …
1160
It will be a while before the kids will see fireworks again, thanks Disney. Fill the skies above your home with some pixie dust. With some modern-day magic we are taking you to the best seat in …
900
Got email about this, don't know if its target or not, cant find the link anywhere, but got the screenshot. Activate by 3rd May
1790
Found and purchased this from the ongoing HBO TV Deals at the Google Play Store. All episodes from Season 1 - 5 are available. Note that Season 6 is the latest season.
1520
cheeky40
Originally found on choicecheapies here: https://www.cheapies.nz/node/23300 Seems like it works on the .com.au store too though! For some reason their domain seems to have changed from …
1532
Eligible pensioners receive the following products free of charge: Registration Costs Licences Driving tests Riding skills test Heavy Vehicle Competency Based Assessment (CBA) …
790
Kills 99.99% of germs without water With Aloe Vera Extract. Helps leave hands feeling soft and refreshed. Dermatologically tested
680
MACCASLOVE
Free delivery with a spend of over $25 at McDonald’s via Uber Eats. Saw this on Facebook so should probably work for all and isn’t targeted.
2720
LEGO® Life Magazine is super-fun for kids 5 to 9 years old. It’s packed with comics, activities, posters and much more, all delivered right to your home 4 times a year. All you have to do is …
1170
As reported - Between April 29 and May 6, you’ll be able to access Turf War, Ranked Battle, and even Salmon Run – you’ll even be playing against people who have the full game. So if …
170
This is the story of an unexpected encounter between Mario and the irreverent Rabbids. The Mushroom Kingdom has been torn apart by a mysterious vortex, transporting the Rabbids into the once-peaceful …
3820
Responding to teachers’ requests for access to documentaries https://media.netflix.com/en/company-blog/free-educational-d... For many years, Netflix has allowed teachers to screen …
1970
Overcooked! 2 - Surf 'n' Turf - was $8.50 Available 3am 17/4 to 3am 22/4 Get your sunglasses on, gather your chef squad and fire up the barbecue…IT’S TIME TO GO TO THE BEACH! …
- 33
- Gaming
- Freebie
- 22 Apr 2020 3:00am
5960
Another freebie game from Ubisoft. Free from April 14. Based on the start time for Child of Light and Rayman's Legend, I believe the start time will be around 11.00pm on the 14/4. Credit to …
940
PBOLT15
After somehow being able to source a Nintendo switch [Neon] I needed some games, now most of these games separately are $70+ so to bundle them and have it delivered I thought it was an alright …
1070
Did a double-take this morning at Coles when I saw this. Unsure if this is only at the Bondi junction branch or state/nationwide. Usually around 30+/kg from memory. All lamb cutlets marked with the …
470
Great price on these drinks thought I'd post as a deal, full credit to frondono for the find
3752
KFCatHOME
Found this today free KFC delivery and considering they charge almost $9 per delivery this should be a good deal. First time post so if u ain't happy with the format or anything else shout …
2310
Hi Everyone, I was looking through all the expired deals for Boost $150 starter kit, and found Doweyy 's deal from Feb/March. The packs should back in stock. If OOS, looks like they can be …
33110
EATLOCALAUS
Greetings everyone, Uber Eats are running 15% off for pickup orders :) Uber is supporting local restaurants with a 0% service fee on pickup orders. To make it easier for you to support your …
570
Because I’m happy…Myer have some Happy Socks on clearance with 30% off plus further 10% off brings price down to $6.30 a pair. Extra 10% off ends tonight. We did it. Myer you’ve been …
6084
Stay safe, and enjoy :) To all the heroes working hard across the nation’s hospitals, thank you for making a difference to many in these challenging times - you’re incredible 🥰 As a …
This deal is not published.
50% off 1 Year Zoom Pro Subscription $115 (Was $231) - New Customers Only (Requested by TechSoup)
710
Full instructions in link, but basically once you've played both on the same Nintendo account go into Pocket Camp, go to My Nintendo in game (not on website), redeem offer and you'll get 50 …
3290
Credit to stickyfingers, TA & monstermash Get your money back on return shipping. Activate Refunded Returns. You’ll be eligible for a refund on return shipping costs from your next …
- 55
- Other
- 4 Nov 2020 8:43pm
3632
Free ubereats delivery for ING Orange Everyday and Orange One customers everyday until April 30. Apply coupon codes on ubereats app and pay with ING card. Mod: Want a code? Request it in the Code …
3090
Hi all, first time poster. This Way Up, at St Vincent’s Hospital in Sydney, is a specialised anxiety clinic that has produced some excellent online CBT programs. This Way Up is currently waiving …
![[Android, iOS] Free - Yertle The Turtle - Dr. Seuss - Interactive eBook (Was $5.49) @ Google Play & Apple App Store](https://files.ozbargain.com.au/n/66/539666.jpg?h=400b2a87)
![[PC] Epic - Free - Sid Meier's Civilization VI - Epic Store](https://files.ozbargain.com.au/n/05/539305.jpg?h=6f502ea7)
![[NSW] 1L Bonsoy Almond Milk $2 @ Harris Farm Markets](https://files.ozbargain.com.au/n/87/535087.jpg?h=6b7facdd)
![[Switch] Party Treats - Free @ Nintendo eShop for Owners of Geki Yabba Runner or Robonauts](https://files.ozbargain.com.au/n/33/535033.jpg?h=59eb7fb8)
![[PC] Free - Assassin's Creed II / Child of Light / Rayman Legends @ Ubisoft](https://files.ozbargain.com.au/n/86/534086.jpg?h=ebb7a2a0)
![[Android] Free - Deus Ex GO (Was $9.99) @ Google Play Store](https://files.ozbargain.com.au/n/60/534660.jpg?h=c42ab339)
![[NSW] Free NSW Driver's Licence & Car Registration for Pensioners](https://files.ozbargain.com.au/n/88/533188.jpg?h=b00d51b8)
![[Switch] Splatoon 2 Special Demo 2020 - Free to Play for 1 Week for Nintendo Switch Online Subscribers (30/4 - 6/5)](https://files.ozbargain.com.au/n/34/532634.jpg?h=565250eb)
![[Switch] Mario + Rabbids Kingdom Battle $29 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU](https://files.ozbargain.com.au/n/54/532054.jpg?h=7f5cc7d1)
![[PC] Free DLC - Overcooked! 2 - Too Many Cooks Pack | Overcooked! 2 - Surf 'n' Turf (Base Game Required) @ Steam](https://files.ozbargain.com.au/n/54/529954.jpg?h=eb07d0d6)
![[PC] Free - Assassin's Creed II (Was $14.95) @ Ubisoft](https://files.ozbargain.com.au/n/34/529934.jpg?h=5fc41807)
![[Switch] Super Mario Odyssey with Super Mario Party & Mario Kart 8 Deluxe $176.76 Delivered @ The Gamesmen eBay](https://files.ozbargain.com.au/n/62/530462.jpg?h=7336adbb)
![[NSW] Lamb Cutlets $12/kg @ Coles, Bondi Junction Westfield](https://files.ozbargain.com.au/n/35/530235.jpg?h=8df50cf9)
![[QLD, WA, NSW, VIC] 50,000 Free Krispy Kreme Doughnuts Delivered to Hospitals for Hospital Workers (Registration Required)](https://files.ozbargain.com.au/n/97/528697.jpg?h=b85dce3d)
![[Switch, iOS, Android] Get Pocket Camp Themed Items in New Horizons/50 Leaf Tickets in Pocket Camp for Playing Both](https://files.ozbargain.com.au/n/43/525643.jpg?h=9841adf3)
