llamarino » deal and competition votes

800
Kirkland Signature Organic Unsalted Cashews 2x 1.13kg $28.99 Delivered @ Costco (Membership Required)

expired Kirkland Signature Organic Unsalted Cashews 2x 1.13kg $28.99 Delivered @ Costco (Membership Required)

Seems like a very decent price considering these are Organic cashews. Total of 2.26KG of cashews! Should be perfect for use in cooking, roasting (or just pigging out!) I hope someone finds this …

4250
Woolworths WISH eGift Cards 5.5% off @ Cashrewards

expired Woolworths WISH eGift Cards 5.5% off @ Cashrewards

Hi all. Woolies has been kind enough to give us another increase for a strictly limited time. Note this promo can be pulled at any time without notice due to budget limitations, so grab your WISH …

1970
50% off Your Next Order (Max $20 off) @ UberEATS

expired 50% off Your Next Order (Max $20 off) @ UberEATS

localfoodfest

You've scored a promo for up to 50% off. Screenshot (Delivery fee applies. Max $20 off) To help support your local restaurants, here's 50% off your next order (delivery fee applies, max …

3460
[PC] Epic - Free - Stranger Things 3: The Game + AER: Memories of Old - Epic Store

expired [PC] Epic - Free - Stranger Things 3: The Game + AER: Memories of Old - Epic Store

The next freebie from the Epic Store. This time it is: Stranger Things 3: The Game and AER: Memories of Old AER: Memories of Old: …

2710
50% off Participating Italian/Pizza Restaurants ($20 Max Discount) @ Uber Eats

expired 50% off Participating Italian/Pizza Restaurants ($20 Max Discount) @ Uber Eats

SUPPORTLOCALITALYSUPPORTITALYLOCAL

Day 8 of the Uber Eats 'Food Fest' is for participating Italian restaurants. 50% off Italian Restaurants (excluding delivery fee, max discount $20 off) until 11:59pm 25/6/2020. Delivery …

1650
[Switch] Ring Fit Adventure $99 Delivered @ Target

expired [Switch] Ring Fit Adventure $99 Delivered @ Target

Edit - appears to be in and out of stock. Looks like the cheapest price for the Ring Fit. From the latest Target catalogue so you might be able to price match elsewhere. Shopback has 0.5% …

3110

expired [PC, Android] Farming Simulator 16 - Free @ Microsoft Store | Google Play

Usually costing ~$6, this game is now currently free at the Microsoft Store Farming Simulator 16 allows you to manage your own realistic farm in extraordinary detail. Plant, grow, harvest, and sell …

630
Libra 50% off Selected Items $1.80-$2.68 @ Woolworths

expired Libra 50% off Selected Items $1.80-$2.68 @ Woolworths

It's been a while since pads and tampons were 50% off. May also be a good time to pick up some half price ice cream thanks to poshjimmyxo Excludes Libra Liners, Tampons pk 42, Prices …

560

expired Lodge L5SK3 8 Inch Cast Iron Skillet $18.44 + Delivery ($0 with Prime & $49 Spend) @ Amazon US via AU

Almost the lowest price ever according to Camel3 I have an 8" carbon steel pan which is a great secondary pan to my 10". A handy size to have in the collection. Unparalleled In Heat …

1571
20% off All Spigen Products + Free Shipping @ Pro Gadgets

expired 20% off All Spigen Products + Free Shipping @ Pro Gadgets

EOFYS2020

They are doing Eofy sales on website. It’s a great deal 20% off + free shipping, from now to 14 Jun. It’s cheaper than their eBay store. Remember to use code “EOFYS2020” at checkout.

1610
Free: Jetbrains Academy Free Trial until January 1, 2021 (Usually $49.95USD Per Month / $71.26AUD Per Month)

expired Free: Jetbrains Academy Free Trial until January 1, 2021 (Usually $49.95USD Per Month / $71.26AUD Per Month)

Found this pretty cool deal from Jetbrains for those who want to start coding. Completely free if you get it before July 1 2020, no credit card details required, just sign in using your gmail account …

560
Google Nest Hub $99 (Any 4 Colours) Delivered @ Google Store

expired Google Nest Hub $99 (Any 4 Colours) Delivered @ Google Store

No the cheapest price, but there are 4 colors to choose in between. Hope this post is useful for someone. :)

6030
[PC] Free - Overcooked @ Epic Games

expired [PC] Free - Overcooked @ Epic Games

The next freebie from Epic Games. Overcooked is a chaotic couch co-op cooking game for one to four players. Working as a team, you and your fellow chefs must prepare, cook and serve up a variety …

14516
15% off Pick up Orders (Max $10 off) @ Uber Eats

expired 15% off Pick up Orders (Max $10 off) @ Uber Eats

CHOOSEPICKUP

15% off pick up orders with Uber eats x 5 times Expires 30th June Maximum discount of $10

1701

out of stock twohundredº Cold Brew Coffee Maker $49 Delivered (Was $129) @ twohundredº Amazon AU

COLDBREW49

WE HAVE RE-STOCKED - AGAIN! Hi OzBargainers! We posted this deal at the end of March but unfortunately ran out of stock within a few hours before a lot of you had chance to get one. We then …

5590
Free Three-Card Pack Delivered @ Hallmark Australia

out of stock Free Three-Card Pack Delivered @ Hallmark Australia

There's no better time to put more care in the world. Get your free card pack and start sending out a little extra love and support. #CareEnough Offer valid while supplies last. Offer of …

1410

expired [eBook] Free: "How to Cook with Bacon" $0 @ Amazon

BACON BACON BACON Similar but better (just because 'bacon') than this [deal] (https://www.ozbargain.com.au/node/539809) This Guide Will Help You: • Learn how to cook different kinds …

2090
[Android, iOS] Free - Yertle The Turtle - Dr. Seuss - Interactive eBook (Was $5.49) @ Google Play & Apple App Store

expired [Android, iOS] Free - Yertle The Turtle - Dr. Seuss - Interactive eBook (Was $5.49) @ Google Play & Apple App Store

A highly rated Dr. Seuss app your young ones. Apple App store Join Yertle the Turtle, king of the pond, in this interactive book app as he commands the other turtles to stack themselves beneath …

550

out of stock De'Longhi Dragon 4, Portable Oil Column Heater, 1200W, TRD41200MT, White $99.99 Delivered @ Amazon AU

Long-lasting and uniform warmth thanks to the long thermal inertia of the oil inside the unit – recommended for rooms up to 35m3 - 7 Year Warranty on all De’Longhi Oil Column Heaters XXL Extra …

800
Lock & Lock 12L Pantry Container $19.99 Cast Iron Cookware - Dutch Oven $24, French Pan $26.99, Frypan $17.99 @ ALDI Special Buy

expired Lock & Lock 12L Pantry Container $19.99 Cast Iron Cookware - Dutch Oven $24, French Pan $26.99, Frypan $17.99 @ ALDI Special Buy

Store bulk rice, flour or grains in this large Rice Case which has a 12 litre capacity and features an angled flip open hatch opening for easy access. It comes complete with a cup for scooping …

16040
[PC] Epic - Free - Sid Meier's Civilization VI - Epic Store

expired [PC] Epic - Free - Sid Meier's Civilization VI - Epic Store

The next freebie from the Epic Store is here. This time it is Sid Meier's Civilization VI. Enjoy! Note: The Platinum Upgrade can be bought in the current sale with the $15 off coupon for …

550
$10 off $150 Spend @ Woolworths Online

expired $10 off $150 Spend @ Woolworths Online

WOOLIES10

*Offer valid from 00.01 AEST 22.5.2020 until 23.59 AEST 26.5.2020 with min. spend of $150 on Pick up or Delivery at woolworths.com.au in a single transaction. Discount will be activated when voucher …

1630
Chobani Greek Yoghurt Varieties 170g $0.90 @ Woolworths

expired Chobani Greek Yoghurt Varieties 170g $0.90 @ Woolworths

Enjoy :) Chobani Greek Yoghurt Limited Edition 170g Chobani Low Fat Lemon Yoghurt 170g Chobani No Fat Raspberry Yoghurt 170g Chobani Low Fat Mango Yoghurt 170g Chobani Low Fat Passionfruit Yoghurt …

1010
50% off Tefal Frypans (Free Delivery over $49) @ Myer

out of stock 50% off Tefal Frypans (Free Delivery over $49) @ Myer

Long time lurker, first time poster :) Right on time for Mother's Day. 50% off Tefal fry pans, saute pans and woks, ends tomorrow. Link will bring you to "Tefal pan" keyword …

970
Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

expired Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

This Mother’s Day weekend, treat mum and grab a FREE Magnum Tub on any delivery order from May 9th-10th. Offer is available in valid orders via orders.redrooster.com.au or the Red Rooster …

620

expired Nintendo Switch Pro Controller $79 Delivered @ Amazon AU

Nintendo Switch Pro Controller back on sale at Amazon AU: To get it for $78 ($1 below Amazon price) and free delivery without Prime, click on "7 new from $78.00" and change seller to …

15214

out of stock Nintendo Switch $469 Delivered @ Amazon AU

Back in stock! I’d admit it’s not a deal per se. But I’m sure people will be keen to buy even at rrp given market prices and limited stock. Update: 8/5 Back in stock, (thanks ColstonAUS)

1322
App Exclusive: $6 McChicken Meal + Bonus Cheeseburger @ mymacca's App (09/05/20 Only)

expired App Exclusive: $6 McChicken Meal + Bonus Cheeseburger @ mymacca's App (09/05/20 Only)

This Saturday only https://files.ozbargain.com.au/upload/22042/79470/capture.jp... Enjoy a Small McChicken Meal with lashings of our exceptional McChicken sauce and get a Bonus Cheeseburger to top …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

740
Nintendo Switch Console Grey (New Look Packaging) - $449 @ JB Hi-Fi (Instore Pickup Only)

out of stock Nintendo Switch Console Grey (New Look Packaging) - $449 @ JB Hi-Fi (Instore Pickup Only)

Bought one from JB Hurstville this afternoon. Called them and they said they couldn't hold one for me. Came to pick up one. Also picked up Animal Crossing for $69 from JB. There were about …

2393
25% off Your Order with $30 Minimum Spend at KFC via Menulog

expired 25% off Your Order with $30 Minimum Spend at KFC via Menulog

KFC4MUM

KFC is at it again and offering an unexpected treat this coming weekend. To celebrate Mother’s Day (it’s this Sunday for anyone who isn’t yet organised), KFC is discounting their entire menu …

240
[NSW] 1L Bonsoy Almond Milk $2 @ Harris Farm Markets

expired [NSW] 1L Bonsoy Almond Milk $2 @ Harris Farm Markets

Long the gold standard in soy milk, Bonsoy have now turned their attention now to almond milk. Usually $4.99, $2 is an absolute bargain for those who drink the stuff. Personally I don't like …

840
[Switch] Party Treats - Free @ Nintendo eShop for Owners of Geki Yabba Runner or Robonauts

expired [Switch] Party Treats - Free @ Nintendo eShop for Owners of Geki Yabba Runner or Robonauts

QubicGames have been simultaneously celebrating their 16th birthday as well as raising funds for COVID-19 relief. For the next few days, Party Treats is being offered for free to owners of Geki …

3220
[PC] Free - Assassin's Creed II / Child of Light / Rayman Legends @ Ubisoft

expired [PC] Free - Assassin's Creed II / Child of Light / Rayman Legends @ Ubisoft

Edit - this deal is now live. All three games are now free! Free from May 1-5 if you missed it previously. If the page comes up blank then you may need to load it on a pc according to some users …

3690
[Android] Free - Deus Ex GO (Was $9.99) @ Google Play Store

expired [Android] Free - Deus Ex GO (Was $9.99) @ Google Play Store

Greetings everyone, seems like a great deal on this game from the Play Store :) Challenge all-new turn-based logic puzzles and solve a futuristic mystery in Deus Ex GO, the next tactical board …

640
Earn Bonus Rewards Points (600/1000/2000) on Ultimate Gift Cards ($30/$50/$100) @ Big W

expired Earn Bonus Rewards Points (600/1000/2000) on Ultimate Gift Cards ($30/$50/$100) @ Big W

Earn 600 Bonus Points (Worth $3) on $30 Ultimate Range for Kids, Teens & Students Earn 1000 Bonus Points (Worth $5) on $50 Ultimate Range for Kids, Teens, Students, Him & Home Earn 2000 …

1190

expired Edifier R1280DB Powered Bluetooth Bookshelf Speakers - Black/Brown $106.25 Delivered @ Edifier via Amazon AU

Not the cheapest all time deal but not too bad either. My first plunge into Edifier, I hope this helps out others too.

1090
20% off (Max Discount $1000) @ digiDIRECT eBay

expired 20% off (Max Discount $1000) @ digiDIRECT eBay

PDIGI20

Just noticed this deal while browsing the app. Looks like a good discount, up to a maximum discount of $1000 and 5 uses. Store link: https://www.ebay.com.au/str/digidirectstore Conditions. The …

1766
$30 Menulog Voucher for Essential Workers, Battlers, Elderly and Those in Need @ Menulog

expired $30 Menulog Voucher for Essential Workers, Battlers, Elderly and Those in Need @ Menulog

Greetings everyone, seems like a generous offer from Menulog to support those in these difficult times :) Amid the difficulties many Australians are facing as a result of the Coronavirus …

760
Free 30 Day Trial for Delivery Unlimited (Minimum Spend $100 Per Shop) @ Woolworths (New Delivery Unlimited Customers Only)

expired Free 30 Day Trial for Delivery Unlimited (Minimum Spend $100 Per Shop) @ Woolworths (New Delivery Unlimited Customers Only)

Now that the panic has died down this deal is available again for new customers. Cancel anytime within 30 days. Subscription Prices: Midweek Delivery (Tuesday, Wednesday, Thursday) - $15/Month …

1880

expired The Big Bang Theory Seasons 1 - 12 $9.99 (Normally $249) @ Microsoft Movies and TV

Noticed this on the Xbox App last night, Season 1 - 12 for $9.99. Seasons 1 - 11 are on Netflix, but for those of you that can't wait for Season 12 to pop up not a bad deal. You've only …

1160
Free: Disney World Florida Cinderella Castle Virtual Fireworks via YouTube

expired Free: Disney World Florida Cinderella Castle Virtual Fireworks via YouTube

It will be a while before the kids will see fireworks again, thanks Disney. Fill the skies above your home with some pixie dust. With some modern-day magic we are taking you to the best seat in …

900
3x-5x Woolworths Rewards Points on Any Purchase @ Woolworths (Activation Required)

expired 3x-5x Woolworths Rewards Points on Any Purchase @ Woolworths (Activation Required)

Got email about this, don't know if its target or not, cant find the link anywhere, but got the screenshot. Activate by 3rd May

1790
HBO Silicon Valley Season 1-5 $14.99 (Normally $99.99) @ Google Play Store

expired HBO Silicon Valley Season 1-5 $14.99 (Normally $99.99) @ Google Play Store

Found and purchased this from the ongoing HBO TV Deals at the Google Play Store. All episodes from Season 1 - 5 are available. Note that Season 6 is the latest season.

1520
40% off @ Blunt Umbrellas ($10 Standard Shipping)

expired 40% off @ Blunt Umbrellas ($10 Standard Shipping)

cheeky40

Originally found on choicecheapies here: https://www.cheapies.nz/node/23300 Seems like it works on the .com.au store too though! For some reason their domain seems to have changed from …

1532
[NSW] Free NSW Driver's Licence & Car Registration for Pensioners

Long Running [NSW] Free NSW Driver's Licence & Car Registration for Pensioners

Eligible pensioners receive the following products free of charge: Registration Costs Licences Driving tests Riding skills test Heavy Vehicle Competency Based Assessment (CBA) …

790

expired Dettol Instant Hand Sanitizer Refresh Green Clip 50ml $4.49 (RRP $4.99) + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Kills 99.99% of germs without water With Aloe Vera Extract. Helps leave hands feeling soft and refreshed. Dermatologically tested

680
Free Delivery with $25 Minimum Spend @ McDonald’s via Uber Eats

expired Free Delivery with $25 Minimum Spend @ McDonald’s via Uber Eats

MACCASLOVE

Free delivery with a spend of over $25 at McDonald’s via Uber Eats. Saw this on Facebook so should probably work for all and isn’t targeted.

2720

expired 4 Free LEGO Life Magazines Delivered Per Year for Kids 5 to 9 Years Old @ LEGO.com

LEGO® Life Magazine is super-fun for kids 5 to 9 years old. It’s packed with comics, activities, posters and much more, all delivered right to your home 4 times a year. All you have to do is …

1170
[Switch] Splatoon 2  Special Demo 2020 - Free to Play for 1 Week for Nintendo Switch Online Subscribers (30/4 - 6/5)

expired [Switch] Splatoon 2 Special Demo 2020 - Free to Play for 1 Week for Nintendo Switch Online Subscribers (30/4 - 6/5)

As reported - Between April 29 and May 6, you’ll be able to access Turf War, Ranked Battle, and even Salmon Run – you’ll even be playing against people who have the full game. So if …