flipsahoy » deal and competition votes

1840
Spend $20 at Any* Merchant (Except Woolworths GiftCards), Get $20 CashBack @ Cashrewards

expired Spend $20 at Any* Merchant (Except Woolworths GiftCards), Get $20 CashBack @ Cashrewards

Received an email from cashrewards! Terms and conditions This promotion is open only to members that receive an invitation email directly from Cashrewards. To be eligible for the AUD $20 bonus, …

230

expired The LEGO Ideas Book Hardcover $14.99 (RRP $39.99) + Delivery (Free with Prime/ $39 Spend) @ Amazon AU

I went looking for another LEGO ideas book and found this. LEGO®: The LEGO® Ideas Book: You Can Build Anything The LEGO Ideas Book is packed full of tips from expert LEGO builders on how …

1060
[VIC, QLD, WA, ACT] $2 Handrolls + Free Delivery (Minimum $10 Order) at SushiSushi on Menulog

expired [VIC, QLD, WA, ACT] $2 Handrolls + Free Delivery (Minimum $10 Order) at SushiSushi on Menulog

$2 Handrolls + Free DELIVERY Start Today at SushiSushi on Menulog from now till 18 of Sep.

570
Free Delivery (Tacos $3 Delivered) @ Guzman Y Gomez via Menulog (Stack with up to 15% Cashback ( $30 Cap) @ ShopBack)

expired Free Delivery (Tacos $3 Delivered) @ Guzman Y Gomez via Menulog (Stack with up to 15% Cashback ( $30 Cap) @ ShopBack)

Edit - 15% cashback (new Menulog customers) and 5% cashback (existing) capped at $30 via Shopback. Tacos are currently $3 for a limited time. Order through Menulog to get them delivered for …

600
[Switch] Pikuniku $4.87 @ Nintendo eShop

expired [Switch] Pikuniku $4.87 @ Nintendo eShop

Has great reviews. Looks like a relaxing game with funny writing and delightful, catchy visuals. 75% off

280
12% off Sitewide @ iHerb

expired 12% off Sitewide @ iHerb

IHERB12

Back by popular demand, enjoy 12% off your next order with promo code IHERB12. Please note: Exclusions apply. May not be combined with other offers. Offer ends 8/31/20 at 10:00 AM PT.

100
[VIC] Ferguson Plarre - Free Small Coffee for Members (via My Sweet Rewards App)

expired [VIC] Ferguson Plarre - Free Small Coffee for Members (via My Sweet Rewards App)

https://apps.apple.com/au/app/ferguson-plarre-sweet-rewards/... - link to Apple Store https://play.google.com/store/apps/details?id=com.shift8.fer... - link to Play Store not sure if targeted but …

5840
$2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

expired $2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

Hi everyone. Another nice bonus for our members which works out to a 9% saving on a $50 gift card, although the bonus does apply to any purchase of $50 or more. Further, the bonus will be approved to …

4120
OzBargain Exclusive - $2 Bonus Cashback with Any Purchase over $5 for All Users (App Required)* @ ShopBack

expired OzBargain Exclusive - $2 Bonus Cashback with Any Purchase over $5 for All Users (App Required)* @ ShopBack

OZB14AUG

Hi everyone, Happy Friday! We're offering all OzBargainers an exclusive $2 cashback bonus (strictly limited to one bonus per customer) when you make a purchase of $5 or more (excluding delivery …

160
[Switch] Cat Quest - $3.10 (Was $15.50, 80% off), Cat Quest II - $15.75 (Was $22.50, 30% off) @ Nintendo eShop

expired [Switch] Cat Quest - $3.10 (Was $15.50, 80% off), Cat Quest II - $15.75 (Was $22.50, 30% off) @ Nintendo eShop

Cat Quest at it's all time low. The first game has become a bit of a "cult classic" in terms of reception online. The sequel has come out more recently and has a better critical …

140
[PC] DRM-free - Stardew Valley $10.19/Crypt of the Necrodancer $3.59/Unavowed $10.49/Iconoclasts $7.49 - GOG

expired [PC] DRM-free - Stardew Valley $10.19/Crypt of the Necrodancer $3.59/Unavowed $10.49/Iconoclasts $7.49 - GOG

Great prices for these games and the cherry on top is they come DRM-free. 😉👍👌 Crypt of the Necrodancer: https://www.gog.com/game/crypt_of_the_necrodancer Unavowed: …

841
Menulog (Delivery): $5 Cashback Bonus (Min Spend $10) + 25% New Users / 10% Existing | iHerb: 20% | Catch: up to 10% @ ShopBack

expired Menulog (Delivery): $5 Cashback Bonus (Min Spend $10) + 25% New Users / 10% Existing | iHerb: 20% | Catch: up to 10% @ ShopBack

Some new cashback flash deals from Shopback. 4pm - iHerb - 20% 6pm to 11.59pm- Menulog - $5 bonus plus 10% cashback (existing Menulog customers) or 25% (new Menulog customers). Receive a $5 …

1050

expired [Prime, eBook] Amazon First Reads - Early Access + Choose 1 of The 8 Kindle Books for August 2020 for Free

Note: It looks like Amazon have changed this offer from two to one free book for Prime members: though the email copy still mentions two in some places, the landing page says one. Get early access …

1220
Amazon AU: up to 6% Cashback for 8 New Categories @ ShopBack

expired Amazon AU: up to 6% Cashback for 8 New Categories @ ShopBack

I noticed that there were some new categories added to Amazon for both SB & CR. ShopBack is offering 4% cashback for these categories (previously 0%) - toys baby products mobile phones and …

6680
$2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

expired $2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

Hi everyone. Another nice bonus for our members which works out to a 9% saving on a $50 gift card. Further, the bonus will be approved to you within 10 days. Please read the terms and activate the …

1780
Free: 1 Lucky Egg, 1 Charmander Stickers & 5 Ultra Balls, 5 Stickers, 5 RazzBerry + Star Piece @ Pokemon GO

expired Free: 1 Lucky Egg, 1 Charmander Stickers & 5 Ultra Balls, 5 Stickers, 5 RazzBerry + Star Piece @ Pokemon GO

UWJ4PFY623R5X9fc4sn7k5daj6MQE4PFNYVRM6M

Enjoy :) First code: 1 Lucky Egg, 1 Charmander Stickers and 5 Ultra Balls @ Pokemon GO Second code: 5 Stickers, 5 Razz Berry and x1 Star Piece (Thanks to Elitethem) Third Code: 5 Great balls, 1 …

1130
[iOS, Android] Free - 10 Ultra Balls + 10 Max Potions + 1 Sinnoh Stone @ Pokemon Go

expired [iOS, Android] Free - 10 Ultra Balls + 10 Max Potions + 1 Sinnoh Stone @ Pokemon Go

5PTHMZ3AZM5QC

Just saw this on Facebook - You Trainers are fast! Thanks or participating, the puzzle has been solved! As a bonus for playing this week, we're giving you this bonus code (redeemable through …

420
Uber Eats - 2 Free Deliveries For Next 7 Days

expired Uber Eats - 2 Free Deliveries For Next 7 Days

eats719

Check you account for a promo, this is likely to be targeted like last week's and will have different levels of offers. Mine was 2 free deliveries for the next week, no minimum spend. Add your …

1140

out of stock Sistema Microwave Rice Steamer 2.6L, BPA-Free Red $5.50 + Delivery ($0 with Prime/ $39 Spend) @ Amazon

Size: 2.6L Rice steamer with a pressure chamber tray for cooking optimum rice every time; 11 cup capacity Features Sistema KLIP IT easy locking clips; steam release vent in lid for splatter-free …

80

expired Atkins Plus Protein Low Carb Low Sugar Shake Banana/Iced Coffee/Chocolate 6pk $13.20 + Post ($0 Prime)/$11.88 S&S (Exp) @ Amazon

+Shipping: $0 with prime or spend $39 Low carb (2.3g), Low sugar (1.7g), High Protein (25g), Great Taste Atkins Plus Protein shakes are packed with 25 g protein to support muscle recovery and …

180
1/2 Price OGX, Hask, Herbal Essences, 40% off Hair Care, NYX, L’Oréal, Maybelline, Olay & ProX, Garnier @ Priceline

expired 1/2 Price OGX, Hask, Herbal Essences, 40% off Hair Care, NYX, L’Oréal, Maybelline, Olay & ProX, Garnier @ Priceline

Priceline is having a 3 day 40% off hair care + miscellaneous brand sale starting today, in-store and online. Hair care 1/2 price Herbal essences 1/2 price OGX 1/2 price Fudge 1/2 price Hask 40% …

810
50% off All NOYA Nut Spreads 200-250g: ABC, Almond, Cashew, Hazelnut $4.25 ($17-$21.25/kg); Macadamia $6 ($30/kg) @ Woolworths

expired 50% off All NOYA Nut Spreads 200-250g: ABC, Almond, Cashew, Hazelnut $4.25 ($17-$21.25/kg); Macadamia $6 ($30/kg) @ Woolworths

previous deal - good alternative to Mayver's ABC - Almond, Brazil & Cashew 250g $4.25 Cashew 250g $4.25 Almond 250g $4.25 Hazelnut (& Cashew) 200g $4.25 Macadamia (& Cashew) 200g …

560
[iOS, Android] Free - 3 Revive, 3 Potions, 3 Pinap Berries @ Pokemon Go

expired [iOS, Android] Free - 3 Revive, 3 Potions, 3 Pinap Berries @ Pokemon Go

FTT7V6NDZ6B8XLEQ8C2BQXJATZ

Another freebie for Pokemon Go. I was able to redeem successfully. FTT7V6NDZ6B8X - 3 Revives and 3 Potions. LEQ8C2BQXJATZ - 3 Pinap Berries

220
Purchase Any 2 Bega Natural Cheese Slices, Stringers, or Sticks Products for a Personalised Drink Bottle ($5 Postage) @ Bega

expired Purchase Any 2 Bega Natural Cheese Slices, Stringers, or Sticks Products for a Personalised Drink Bottle ($5 Postage) @ Bega

BUY ANY TWO Bega Natural Cheese Slices, Stringers, or Sticks packs in one transaction and able to design a water bottle for $5. Terms and Conditions Who can claim? Only Australian residents …

4570
$20 off Pickup Orders (Works for Existing Customers) @ Uber Eats (Rewards Members)

expired $20 off Pickup Orders (Works for Existing Customers) @ Uber Eats (Rewards Members)

BGAU20

Received this via email, as part of UberEat's final foodfest deal. Email: $20 to spend on Pickup* … , who said there's no such thing as a free lunch? To celebrate the last …

1840
Free Office 365 for Students and Teachers @ Microsoft Office

expired Free Office 365 for Students and Teachers @ Microsoft Office

Here's a another great OzReminder for students and parents. Students and educators are eligible for Office 365 Education for free, including Word, Excel, PowerPoint, OneNote, and now …

280
3 Day 1/2 Price Makeup Including NYX (Some Brand Exclusions) and Selected Masks and Wipes Sale @ Priceline

expired 3 Day 1/2 Price Makeup Including NYX (Some Brand Exclusions) and Selected Masks and Wipes Sale @ Priceline

Got an email from Priceline - their 1/2 Price Make-up sale starts 17 June and runs for 3 days. From the terms these brands are excluded: Nude by Nature, Opallac Starter Kit, Opallac UV LED Lamp …

610
½ Price Sanitarium UP&GO Liquid Breakfast Varieties 6Pk $4.50 ($4.85 in NSW) @ Woolworths

expired ½ Price Sanitarium UP&GO Liquid Breakfast Varieties 6Pk $4.50 ($4.85 in NSW) @ Woolworths

Sanitarium UP&GO Liquid Breakfast Banana 6Pk Sanitarium UP&GO Liquid Breakfast Choc Ice 6Pk Sanitarium UP&GO Liquid Breakfast Strawberry 6Pk Sanitarium UP&GO Liquid Breakfast Vanilla …

80
40% Off Site-Wide + $7.95 Shipping/ Free With $50 @ Andalou Naturals

expired 40% Off Site-Wide + $7.95 Shipping/ Free With $50 @ Andalou Naturals

EOFY40OFF

Andalou Naturals official site has 40% off at the moment with EOFY40OFF. Appears to be exactly the same offer as the Sukin, even right down to the email format and code. Also 40% off at Priceline, …

230

expired [Prime, eBook] Amazon First Reads - Early Access + Choose One of The Eight Kindle Books for June 2020

Amazon First Reads is a program that offers customers early access to new books across popular genres from Amazon Publishing. Every month customers can choose one of the six Kindle books selected by …

260

out of stock Baccarat iD3 Japanese Steel 3 Piece Santoku Knife Set $50 + Free Delivery @ House

SHIP35

Obviously their claim of 82% off RRP $279.99 doesn't mean much, but $50 is still a reasonable price for a set of 3 decent looking knives. Large Santoku Blade: L18cm, Medium Santoku Blade: …

80

expired 60% off BIC Fashion 4 Colour Grip Pen 10pk $12.10 (Was $30.00) + Delivery ($0 with Prime / $39 Spend) @ Amazon Australia

Save $17.90 when you buy this box of 10 BIC 4-Colour fashion pens Has been reduced to $12.10 from $30.00 as part of Amazon Mid Year Event There are also some good deals in markers and other writing …

90
[VIC] Free Small Coffee via App @ Ferguson Plarre (Free Membership Required)

expired [VIC] Free Small Coffee via App @ Ferguson Plarre (Free Membership Required)

Just received this email from Ferguson Plarre, new users can also get this offer (credit to gottacatchemall) Link to email.

100
ASN (Australian Sports Nutrition) 18th Birthday Specials, up to 75% off (Mostly Everything Is 20% off)

expired ASN (Australian Sports Nutrition) 18th Birthday Specials, up to 75% off (Mostly Everything Is 20% off)

SHIPPING4FREE

ASN are celebrating their 18th birthday and are having a massive sale on Saturday, 6 June only. The flyer is here: https://www.australiansportsnutrition.com.au/birthday-sale BSc Clean ACV (Apple …

200
T2 Mid Year Sale on Teawares (up to 50% off), Tea and Gift Packs (up to 30% off) Free Shipping over $50 or Pick-up in Store

expired T2 Mid Year Sale on Teawares (up to 50% off), Tea and Gift Packs (up to 30% off) Free Shipping over $50 or Pick-up in Store

Various tea wares and weird teas, the mid year sale is brewing! The tea choices are not as good as the Amazon one (Gutted that I missed out on that), but you might find your cup of tea. If you are …

120

expired Atkins Shake Varities, 6x330ml Vanilla/Coffee $12.18, Chocolate $14.66 + Delivery ($0 Prime/ $39 Spend) @ Amazon AU

Chocolate currently $3.65 each at Woolworths Using links below seems to be eligible for S&S Vanilla / Coffee works out to be $2.03 Each ($10.96 = $1.83 S&S) Chocolate works out to be $2.44 …

560
Steggles Whole Roast Chicken $2.90 Per kg @ Woolworths

expired Steggles Whole Roast Chicken $2.90 Per kg @ Woolworths

Steggles Whole Roast Chicken $3 Per kg @ Woolworths (1.8 - 2.65 kg) weights will differ between States.

1670

expired 10% off Nintendo E-Shop Gift Cards, Nintendo Labo Kits $29, Hot Wheels 10 Pack $9.50 @ BigW

Starts 16/6 online and 18/6 in-store. 10% off Nintendo e-shop $15, $30 & $60 gift cards - offer valid 18/6 to 24/6, in-store only. Nintendo Labo kits $29 Nintendo Switch $449 Nintendo Switch …

1010

expired NutriBullet 1200W Series Blender 10 Piece Set, Silver $107 Delivered (Was $199.99) @ Amazon AU

NutriBullet 1200W Series Blender 10 Piece Set, Silver Amazon Deal of the Day with FREE Delivery Lowest price on camelx3

14290
$15 off Your Order (Pick up / Delivery) @ Menulog (Min $16 Spend - Including Delivery Fee)

expired $15 off Your Order (Pick up / Delivery) @ Menulog (Min $16 Spend - Including Delivery Fee)

ESL15

Menulog has partnered up with ESL Australia. As part of ESL's Counter-Strike's ANZ Champs starting today, they've given out a code just for tonight. Minimum spend is $16 (includes …

840
Earn 5x Points on Total Shop with $15 Spend on Meat @ Woolworths Rewards

expired Earn 5x Points on Total Shop with $15 Spend on Meat @ Woolworths Rewards

5x Poins on $15 Spend in Woolworth Meat @Woolworths Terms and conditions When Promotion runs from 00:01 AEST 25/05/20 to 23:59 AEST 31/05/20. Where Available at Woolworths Online, in store at any …

5540
OzB Exclusive: $2 Bonus Cashback with Minimum $5 Spend at Any Store @ Cashrewards (Activation Required, Excludes Woolies GCs)

expired OzB Exclusive: $2 Bonus Cashback with Minimum $5 Spend at Any Store @ Cashrewards (Activation Required, Excludes Woolies GCs)

Click Frenzy is upon us for another year and we have plenty of great deals on-site for you to take advantage of. Please read the terms and activate the offer prior to shopping as you normally would …

220

out of stock Head & Shoulders Smooth & Silky Anti-Dandruff Shampoo 620mL $7.50 ($6.75 S&S) + Delivery (Free with Prime) @ Amazon

Similar to this. Price is only for the Smooth & Silky, not for all other conditioners.

110

expired Atkins Low Carb Crispbread 100g $1.80 Delivered (S&S) @ Amazon AU

Max 5 per customer while stocks last. Product details: Deliciously crunchy crispbread with 50% less carbs. SOMETHING FOR EVERYONE. With tons of variety, you’ll stay on a low carb track while …

7230
$15 off Orders @ UberEATS (New & Existing Accounts)

expired $15 off Orders @ UberEATS (New & Existing Accounts)

77EATS

I saw a previous deal that had $15 off for first time ubereats and the code was 66EATS. I randomly tried 77EATS and the code worked for me even though I have many orders on my account. try it out or …

820
Earn 400 Points on $20 Google Play or Netflix Gift Card | 1000 Points on $50 Google Play, Uber or Netflix Gift Card @ Woolworths

expired Earn 400 Points on $20 Google Play or Netflix Gift Card | 1000 Points on $50 Google Play, Uber or Netflix Gift Card @ Woolworths

Earn 400 Points (Worth $2) on $20 Google Play or Netflix Gift Cards May not be available in all stores. Colours, sizes and styles may vary by store. While stocks last. Available on all …

1010
50% off Tefal Frypans (Free Delivery over $49) @ Myer

out of stock 50% off Tefal Frypans (Free Delivery over $49) @ Myer

Long time lurker, first time poster :) Right on time for Mother's Day. 50% off Tefal fry pans, saute pans and woks, ends tomorrow. Link will bring you to "Tefal pan" keyword …

2530
[VIC] Free Pair of Shoes for All Health & Aged Care Workers @ Bata Shoes [Mornington]

expired [VIC] Free Pair of Shoes for All Health & Aged Care Workers @ Bata Shoes [Mornington]

This is a global initiative. ID required to pick up a free pair. Sign is posted in Mornington Victoria. Stay safe, and enjoy :)

920
[iOS, Android] 1x Remote Raid Pass for 1 PokéCoin @ Pokémon Go

expired [iOS, Android] 1x Remote Raid Pass for 1 PokéCoin @ Pokémon Go

Usually 100 coins each or 3 for 250 coins. Happy remote raiding!

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …