cyssero » deal and competition votes

1780
Cascade Mesh Chair - Ergonomic Office Chair $199 Free Metro Shipping @ Epic Office Furniture

expired Cascade Mesh Chair - Ergonomic Office Chair $199 Free Metro Shipping @ Epic Office Furniture

Cascade199

This chair is listed at $249.00 on their website, however, the chat rep said they will be able to honour last month's deal for all OzBargainers. Enter the promo code at checkout and remove …

660

expired Lenovo ThinkVision M14t 14" Portable IPS Touchscreen Monitor with Active Pen $479.21 (Introductory Price) @ Lenovo

INTRO

Hi all, For anyone needing a USB-C (USB3.2) mobile monitor (14") or just wanting to dabble with touch + stylus on their Windows device and not buy a Wacom - here's an alternative. 8% …

220

expired Sony WF-1000XM3 Truly Wireless Noise Cancelling in-Ear Headphones (Black & Silver) $245.65 (Free C&C) @ digiDIRECT

Available in Black and Silver. Apparently free shippng (> $99 spend) until end of 26 July 2020 (Sun). Can't seem to find when this deal will end. Key Features of the Sony WF-1000XM3 Truly …

900
50% off mIRC Internet Relay Chat Client US$10 (~A$14.07) @ mIRC (Normally US$20)

expired 50% off mIRC Internet Relay Chat Client US$10 (~A$14.07) @ mIRC (Normally US$20)

MIRC-SWV0-MNKL

Updated: thanks to BarginHunter for finding 50% off!. IRC is a really old, but still highly used chat system. I came across this promo when my trial just expired so I purchased my copy. This …

140

out of stock Mayver's Smooth Dark Roast Peanut Butter 375g $2.50 + Delivery ($0 with Prime/ $39 Spend) @ Amazon AU

Do you want to buy apocalyptic quantities of Mayver's for half price at Woolworths? Are you embarrassed about what the checkout staff will think when they see you've got a decades supply of …

1681
½ Price Mayver’s Peanut Butter 375g $2.50, Harry’s Ice Cream 520ml $3, Kettle Chips 150-175g $2.32 @ Woolworths

expired ½ Price Mayver’s Peanut Butter 375g $2.50, Harry’s Ice Cream 520ml $3, Kettle Chips 150-175g $2.32 @ Woolworths

Mayver’s Peanut Butter 375g - $2.50 Mayver's Crunchy Peanut Butter 375g Mayver's Smunchy Skin On Peanut Butter 375g Mayver's Smunchy Protein Plus Hemp Seed Peanut Butter …

1280
TPG Fibre To The Building 3 Months Free (Available to TPG FTTB Locations Only) @ TPG Internet

expired TPG Fibre To The Building 3 Months Free (Available to TPG FTTB Locations Only) @ TPG Internet

FTTBFREE3

Already an existing customer but called yesterday and they applied this voucher to my account anyway. Saved $180 in total worth it And honestly TPG works better than the top Vodafone $95 joke plan I …

80
SAL (Sunny Lighting) S9065TC 9W LED Downlight Dimmable IP44 Tri Colour $9.90 (Was $12.90) + Delivery @ Best Buy Lighting

expired SAL (Sunny Lighting) S9065TC 9W LED Downlight Dimmable IP44 Tri Colour $9.90 (Was $12.90) + Delivery @ Best Buy Lighting

Great deal for anyone who looking for upgrade the LED Down lights. This is limited time offer as state on website banner. Just grabbed some bargains. SAL Wave S9065TC 9W LED Downlight …

1390
Farewell Jumbo 747 Joy Flights - Economy $400, Business Class $747 @ QANTAS

out of stock Farewell Jumbo 747 Joy Flights - Economy $400, Business Class $747 @ QANTAS

Last flights on the final 747 jumbo. Qantas has announced a program of events to farewell its last remaining Boeing 747 and provide Australians the opportunity to say goodbye to the much loved …

270
Citizen Eco Drive CA4455-86X $299 Delivered (Was $699) @ Starbuy

expired Citizen Eco Drive CA4455-86X $299 Delivered (Was $699) @ Starbuy

Beautiful watch, great features. At a bargain price. I have bought many watches from Starbuy. They ship fast and have great deals.

70
Baseus Car Aux Bluetooth Adapter Handsfree Wireless 3.5mm Audio Receiver A$10.35 Delivered @ eSkybird

expired Baseus Car Aux Bluetooth Adapter Handsfree Wireless 3.5mm Audio Receiver A$10.35 Delivered @ eSkybird

OZBE032

Add bluetooth to your Car, Plug and Play for Car and Other Aux Input Audio Equipment. Don't forget to apply code OZBE032 at checkout. Another Baseus Aux Bluetooth Receiver Deal: 3.5mm Jack …

790
Cetirizine Hydrochloride 10mg Chemists' Own C-Zine (Zyrtec Generic) 140 Tablets (2x 70 Tabs) $20.99 Delivered @ PharmacySavings

out of stock Cetirizine Hydrochloride 10mg Chemists' Own C-Zine (Zyrtec Generic) 140 Tablets (2x 70 Tabs) $20.99 Delivered @ PharmacySavings

take9

Hi Again Ozbargaineers, We've received a literal truck load of stock into our tiny shop today and after sweet talking one of our reps, we were able to secure a great deal on Chemists' Own …

1701
Free 100% Cotton Face Mask (Pickup) @ LookSmart Alterations

expired Free 100% Cotton Face Mask (Pickup) @ LookSmart Alterations

FREEFM20

To help you stay safe, we want to give you a FREE* face mask, made with love and care by our professional tailors. Our masks are made with 100% cotton and can be washed and re-used into the future. …

1560
Free Album: RTJ4 by Run The Jewels (also RTJ2 & RTJ3)

expired Free Album: RTJ4 by Run The Jewels (also RTJ2 & RTJ3)

Stay safe, and enjoy :) Run The Jewels' Killer Mike and El-P have announced they plan to release their new album ‘Run The Jewels 4’ for free. “I don’t have shit left to say right now …

280
[eBay Plus] Realme 6 (6.5" 90hz, 64MP, 128GB/8GB) $376, Realme C3 (5000mAh, 64GB/3GB) $214 Delivered @ Allphones eBay

expired [eBay Plus] Realme 6 (6.5" 90hz, 64MP, 128GB/8GB) $376, Realme C3 (5000mAh, 64GB/3GB) $214 Delivered @ Allphones eBay

PVOLTAGE

Original [eBay Plus] Nintendo Switch Pre-Order $409.66 Shipped @ The Gamesmen eBay Coupon Deal

630

out of stock Grey Goose Vodka - 700ml $59.90 Delivered @ Amazon AU

Solid price on Grey Goose. Ordered yesterday delivered first thing this morning. Cheers Steve Mod: OP posted without declaring association with product (sockpuppeting), user is banned and …

160
Jabra Elite 65t $149, Active 65t $179 (Save $100) Delivered @ Jabra

expired Jabra Elite 65t $149, Active 65t $179 (Save $100) Delivered @ Jabra

Jabra Elite 65t $149, Active 65t $179 delivered at Jabra.com.au Also available at * Amazon * JB hi-fi * Good Guys * Officeworks * Binglee * Harvey Norman

1690
Samsung Galaxy S20 4G 128GB $897.08, S20 5G 128GB $996.83, S20+ 5G 128GB $1096.58, S20 Ultra 5G 128GB $1329.33 @ Samsung EDU/EPP

expired Samsung Galaxy S20 4G 128GB $897.08, S20 5G 128GB $996.83, S20+ 5G 128GB $1096.58, S20 Ultra 5G 128GB $1329.33 @ Samsung EDU/EPP

UPDATE (04/06): The discount code bug has been fixed and now the EPP prices are also stacking with the $50 Samsung Newsletter offer. So the effective prices are now - Samsung Galaxy S20 5G 128GB …

14516
15% off Pick up Orders (Max $10 off) @ Uber Eats

expired 15% off Pick up Orders (Max $10 off) @ Uber Eats

CHOOSEPICKUP

15% off pick up orders with Uber eats x 5 times Expires 30th June Maximum discount of $10

1040

expired Monopoly Deal Card Game $8.10 + Delivery (Free for Prime Members or with $39 Spend) @ Amazon

For the uninitiated, monopoly has been reborn through this fast-paced, travel-friendly card game. Faster to play than traditional Monopoly, it’s arguably more fun with as much family-division as …

200
Stainless Steel Step Bin Combo (29.7L & 9L) by Eco Living $47.99 (was $59.99) @ Costco (Membership Required)

expired Stainless Steel Step Bin Combo (29.7L & 9L) by Eco Living $47.99 (was $59.99) @ Costco (Membership Required)

I've been searching for months a decent kitchen bin, and couldn't believe how hard it was to find what I thought were basic features until I saw this deal. Standard 30L size (below waist …

270

expired Bose SoundSport Free Truly Wireless Bluetooth Headphones $175 Delivered @ Amazon AU

Hi Ozbargain people, please be gentle with me as this is my first post. Normally i am just look around, but this time let me be part of ozbargain people. Bose Soundsport Free wireless on SALE. …

590
LG E9 65" OLED $3200 (OOS) | LG E9 55" OLED $2300 + Delivery @ Myer

expired LG E9 65" OLED $3200 (OOS) | LG E9 55" OLED $2300 + Delivery @ Myer

c&c doesn't look to have any stock, try calling or add $75 for delivery 55" May want to compare to the 2020 models first, seems like a good price considering the 65" C9 ranged …

110
9W Smart Wi-Fi Downlight White Ambiance $25.46 (was $29.95) + Free Shipping @ Lectory.com.au

out of stock 9W Smart Wi-Fi Downlight White Ambiance $25.46 (was $29.95) + Free Shipping @ Lectory.com.au

OZBARGAIN15

Features Remotely control from anywhere under internet coverage Add and control multiple devices at once with one App Voice control via Amazon Echo and Google Home Interworking of multiple …

121
Dole Pineapple Slices 227g - $1.20 (Normally $1.60) @ Woolworths

expired Dole Pineapple Slices 227g - $1.20 (Normally $1.60) @ Woolworths

Delicious chunks of Dole Pineapple! in Juice! Get it today, nom nom nom!

1970

out of stock Saxa Iodised Table Salt 750g $0.25 (was $2.95) + Delivery ($0 Delivery w/Prime or $39 Spend) @ Amazon AU

Cheap Salt. Don’t over use. Stay healthy and enjoy the deal. Naturally evaporated sea salt Contains iodine that body needs Comes in a convenient plastic dispenser bottle Perfect for …

400

expired Seagate DJI Fly Drive, 2TB $78.87 Delivered @ Amazon AU

Portable 2TB drive for drone footage -Hey i bet it acts like other portable hdd Back up, consolidate and organize 60+ hours of footage on location Integrated UHS-II microSD card slot for quick drag …

500
Samsung SmartThings Wi-Fi Hub $99 + Free Shipping @ RACV

out of stock Samsung SmartThings Wi-Fi Hub $99 + Free Shipping @ RACV

RACV was strangely the distributor in Australia when it was launched over here. I was in Jb hifi and it was at the RRP of $199. This is not the standard Hub but the WiFi mesh capable unit. I've …

1300

out of stock OMEN by HP 27inch 1440p Display Monitor G-Sync 1MS 165hz $488 Delivered @ HP

FRENZY68%

I saw this in my Email saying its on sale and I was looking for some Monitors and this caught my eyes. Don't think its $1400 monitor but a $488 for 165hz G-sync Monitor is good deal in my …

1630
Chobani Greek Yoghurt Varieties 170g $0.90 @ Woolworths

expired Chobani Greek Yoghurt Varieties 170g $0.90 @ Woolworths

Enjoy :) Chobani Greek Yoghurt Limited Edition 170g Chobani Low Fat Lemon Yoghurt 170g Chobani No Fat Raspberry Yoghurt 170g Chobani Low Fat Mango Yoghurt 170g Chobani Low Fat Passionfruit Yoghurt …

210

expired [Back Order] JBL Soundbar 9.1 - True Wireless Surround with Dolby Atmos $1,124.96 Shipped (Was $1,465.86) @ JBL

HARVEY

Note: Back Order. The expected in-stock date is 02 June 2020. - The JBL Bar 9.1 soundbar brings audio experience of a movie theater into your home with two detachable surround speakers and the …

210
Ring Chime Pro (1st Gen) $39.50 Delivered @ Ring eBay

out of stock Ring Chime Pro (1st Gen) $39.50 Delivered @ Ring eBay

Great deal, $39.50 ring chime pro delivered At eBay Ring store

170
Lenovo Smart White Bulb - 2 for $25 (Save $15) (B22 & E27) @ JB Hi-Fi

expired Lenovo Smart White Bulb - 2 for $25 (Save $15) (B22 & E27) @ JB Hi-Fi

I've been looking for some standard white smart globes to go with my Telstra Plus Philips Hue Colour set up. Also available in colour 2 for $40 (save $10. Dim or brighten up any room remotely …

61
Men's Battery Heated Winter Jacket - Battery Pack Included - $199.99 (Save $110, Was $309.99) & Free Shipping @ ORORO

expired Men's Battery Heated Winter Jacket - Battery Pack Included - $199.99 (Save $110, Was $309.99) & Free Shipping @ ORORO

ORORO Men Heated Jacket is now on sale for AUD$199.99 with Free Express Shipping to AU/NZ. It is $219.99 on Amazon AU. Best price on au.ororowear.com. Click Here to Shop ORORO Men Heated …

180

expired James Bond 24x DVD for $75 (Was $150) + $3.90 Shipping @Big W

Ah, I've been expecting you. While considering the half price Futurama box set I found this James Bond box set for half price. Cheaper than iTunes, eBay, Amazon. Pretty much the cheapest …

7230
$15 off Orders @ UberEATS (New & Existing Accounts)

expired $15 off Orders @ UberEATS (New & Existing Accounts)

77EATS

I saw a previous deal that had $15 off for first time ubereats and the code was 66EATS. I randomly tried 77EATS and the code worked for me even though I have many orders on my account. try it out or …

2450
Free: Nvidia RTX Voice (Background Noise Canceller) for RTX 20xx, GTX 9xx, 10xx & 16xx Series GPUs Compatible w/Workaround

Long Running Free: Nvidia RTX Voice (Background Noise Canceller) for RTX 20xx, GTX 9xx, 10xx & 16xx Series GPUs Compatible w/Workaround

RTX Voice filters background noise from both audio input and output with Nvidia Tensor cores. First, the good news: Nvidia's RTX Voice technology actually works really well. As you can hear …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

420
Withings / Nokia Steel HR Smart Watch (Rose Gold/Grey) $169 +Delivery (was $339) @ JB Hi-Fi

expired Withings / Nokia Steel HR Smart Watch (Rose Gold/Grey) $169 +Delivery (was $339) @ JB Hi-Fi

Good price for a decent hybrid watch with long battery life (not sure if it's the cheapest it's been..) that also tracks sleep and heart rate. GPS tracking is done via the HealthMate …

980
ALDI Sim Only Mobile Family Plan $80/Mth, 72GB/Mth Shared Data across 4 SIMs, Unlimited Talk/SMS (some international) via ALDI

expired ALDI Sim Only Mobile Family Plan $80/Mth, 72GB/Mth Shared Data across 4 SIMs, Unlimited Talk/SMS (some international) via ALDI

After posting the Optus deal I noticed this family deal from Aldi wasn't not posted on here. With this plan you pay $80 and get 4 sims with unlimited calls and sms and 72gb to be shared. Unused …

1060
LG OLED65CXPTA 65" 4K Smart TV $3798 + Delivery @ Appliance Central eBay

expired LG OLED65CXPTA 65" 4K Smart TV $3798 + Delivery @ Appliance Central eBay

PILLOW10

This replaces the popular LG C9 OLED TV. Newly released and retails at $4495 at most retailers. This is priced at $3825 with the coupon code. Price is now $3798. Original Coupon Deal

22824
Amazon AU: Up to 7% Cashback @ Shopback

expired Amazon AU: Up to 7% Cashback @ Shopback

Shopback have now joined Cashrewards with identical cashback rates at Amazon AU Cashback Rates Amazon Devices, Jewellery, Apparel, Shoes, Handbag & Accessories 7.00% Sports & …

50
De'Longhi Nespresso Lattissima Touch Coffee Machine - White $397 + $70 Coffee Credit via Redemption @ Harvey Norman

expired De'Longhi Nespresso Lattissima Touch Coffee Machine - White $397 + $70 Coffee Credit via Redemption @ Harvey Norman

My parent's nespresso coffee system broke after 7 years. Thought this is a good price for a replacement. I like these lattisimo units as their milk funxrions are far better than the …

810
Samsung Galaxy Buds+ AU $169.75 Delivered (Grey Import) @ TobyDealsAU

expired Samsung Galaxy Buds+ AU $169.75 Delivered (Grey Import) @ TobyDealsAU

CART3

Probably the best wireless buds right now price/performance wise and especially long battery life - 11 hrs without case. Review/Comparison : …

180
Amazon Echo with Alexa 3rd Generation (Twilight Blue Fabric & Charcoal Fabric) - $79 @ JB Hi-Fi

expired Amazon Echo with Alexa 3rd Generation (Twilight Blue Fabric & Charcoal Fabric) - $79 @ JB Hi-Fi

Looks like JB Hi-Fi matched $79 Amazon prices. Enjoy :) Amazon Echo with Alexa (3rd Generation) [Twilight Blue Fabric] Amazon Echo with Alexa (3rd Generation) [Charcoal Fabric]

140
Allocacoc 2 Outlet Original Power Cube w/ 2x USB (Green) $10, Atlas 14L Anti-Theft Backpack w/ USB & Lock $10 + Delivery @ Catch

expired Allocacoc 2 Outlet Original Power Cube w/ 2x USB (Green) $10, Atlas 14L Anti-Theft Backpack w/ USB & Lock $10 + Delivery @ Catch

Allocacoc 2 Outlet Original Power Cube With 2x USB (Green) - $10 + Delivery The PowerCube Original allows you to power up to 4 devices at once, preventing plugs from blocking each other thanks to …

110
Oppo HA-2 SE Portable DAC and Headphone Amplifier $299 Delivered @ Jaben Audio

out of stock Oppo HA-2 SE Portable DAC and Headphone Amplifier $299 Delivered @ Jaben Audio

Decent price. Going for around $400+ elsewhere ( Lifestylestore, Digital Cinema (HA-2) . ) Difference between HA-2 (ES9018K2M) and HA-2SE (ES9028Q2M) seems to be the DAC chip.

410

expired Polk Audio T50 Floorstanding Speakers (Black/Pair) $416.40 Delivered @ Amazon AU

20% price drop on some nice looking floorstanding Polk Audio speakers to complement your home theatre system. And yes, the price is for a pair, not a single speaker. I'm running Polk Audio gear …

710
[PC] Steam - Max Payne 2: The Fall of Max Payne - $3.49 AUD ($2.97 if you have HB Choice) - Humble Bundle

expired [PC] Steam - Max Payne 2: The Fall of Max Payne - $3.49 AUD ($2.97 if you have HB Choice) - Humble Bundle

Great price for a classic innovative shooter. Yes, the graphics are a bit old now but the gameplay is still heaps of fun. From the website: Max Payne 2: The Fall of Max Payne is a violent, …

90
[VIC] LG 65" B9 4K OLED Smart TV OLED65B9PTA $2699.99 @ Costco Docklands (Membership Required)

expired [VIC] LG 65" B9 4K OLED Smart TV OLED65B9PTA $2699.99 @ Costco Docklands (Membership Required)

It is not the best price. I saw it today in the store and thought it may would help somebody who is after getting like this nice Tv while still the price less than what is available in local stores.