morediscount » deal and competition votes
This deal is not published.
Samsung 860 EVO 1TB SATA 2.5" SSD $159 + Free Delivery @ Centrecom (Unobtainable deal)
6310
While stocks last. T&Cs here. Stay safe, and enjoy :)
80
Original price: $29.99 Sale price: $12.99 MOSSY OAK Tactical LED Flashlight Shock-Proof 300 Lumens and Headlamp 200 Lumens, Battery Powered Helmet Light Combo Kit for Camping, Running, Hiking and …
1230
. Coupon code will be issued before the commencement of Sony Frenzy on 19/05/2020 and is valid until 11:59PM (AEST) 25/05/2020. Only available for a single transaction at Sony Online Store. In order …
23020
Epic Games have confirmed on Twitter that Grand Theft Auto 5 will be the next free game. Get Grand Theft Auto V free on PC until May 21. Yours to keep forever on the Epic Games Store. Here is the …
- 589
- Gaming
- Freebie
- 11 Jun 2020
1610
Some cookbooks that were free at the time of posting. ebook US link AU link Indian Cooking: Learn Authentic Indian Cooking with Easy Indian Recipes US AU Japanese …
250
It is $4 but $3.60 with Subscribe and Save. Description: Satisfies your hunger 10g protein per bar Gluten free No artificial colours of flavours Note: $6.30 at …
750
There is nothing that comes close to the smell of bacon cooking. If you want to find new ways to cook with one of your favorite meats then Bacon Cookbook: 150 Easy Bacon Recipes is the book for …
190
Lightning Deal - Pink $8.66, other colours $11.55 - Reg price $16.99 Product Dimensions - 26.5x22.9x11.4cm
2240
Another Steam freebie to keep. Available 3am 22/05. 10 SECOND NINJA X is a shockingly fast, overwhelmingly intense action/puzzle game. In this thumb blistering sequel, the nefarious Captain …
- 16
- Gaming
- Freebie
- 29 May 2020 3:00am
4000
Free while supplies last or until 3am AEST on Monday the 11th of May. There is also a key redemption deadline of 3am AEST on Friday the 15th of May after you've claimed the game. As usual with …
- 61
- Gaming
- Freebie
- 11 May 2020 3:00am
1002
GYGDELIVERYGYGFREEDELMACCASWIN
Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …
1331
I have seen the recent post of Cities Skylines for less than $8 (What a bargain!) and went to check the DLCs. https://www.ozbargain.com.au/node/531548 <—Get it for less than $8!!! Cities: …
390
Wet Ones Be Gentle Travel Pack, 15 Wipes https://www.amazon.com.au/ONES-GENTLE-TRAVEL-PACK-15CT/dp/B0... and Wet Ones Be Fresh Travel Pack, 15 …
This deal is not published.
Hand sanitizer 500ml %75 alcohol (Spam)
1370
Stay safe :) We wanted to assure you all that we’re offering food for free to vulnerable members in our community who are struggling with the ever-changing COVID-19 pandemic situation. The huge …
890
Saw this available on KG Eletronics eBay store, price is a little more than Chemist Warehouse per bottle at the moment but you won't be able to find stock anywhere. Plus this is 6 bottles which …
440
Surface Cleanser Trigger Kills 99% of germs* Removes 90% of allergens** Great for use on surfaces where food is prepared, stored and eaten No need to rinse Non bleach *Germs such as: Salmonella, …
111
Antibacterial Hand Sanitisers - 75% Ethyl Alcohol with moisturiser. Contains 75% Ethyl Alcohol with Glycerine, Pure Essential Oils (Lavender, Eucalyptus & Lemon Myrtle) & distilled …
260
SBI Sydney is offering Zero remittance fee on AUD-INR transactions for those who are : - Supporting their families and friends back in India to fight COVID-19 - Donating funds to PM Cares Fund to …
1530
STAYINSIDEANDLEARN2
2020 Launch! Learn how to hack like a pro by a pro. Up to date practical hacking techniques with absolutely no filler. HIGHEST RATED 4.7 (4,062 ratings) 26,590 students enrolled What you'll …
2070
Greetings everyone, just spotted this on the front page at Amazon :) Amazon have reduced heaps of childrens and fiction eBooks to help out during this crisis! A selection of free Kindle Books …
970
KLEENEX Facial Special Care Tissues With Aloe Vera and Vitamin E, 1 Box of 95 tissues $1.99 Alternate option: KLEENEX Facial Special Care Aloe Vera & Vitamin E Facial Tissues, 140 sheets $3.00
1920
Similar to yesterday’s post, another incredible gesture of goodwill. Stay safe :) “FOOD FOR HOPE”. We are here for you Mackay - warm meal for anyone who has lost their job or business! In …
1020
Something from Hasbro to get us through the self isolation. Nearly seven hours of GI Joe joy. Let’s revisit the 90s… G.I. JOE: A Real American Hero follows an elite team of soldiers as …
1502
Greetings everyone, this seems like a pretty great price on this game to me :) The Division 2 Playstation 4 Devil May Cry 5 is also $8 In-Store Only. PS4. Star Wars Jedi Fallen Order is …
This deal is not published.
Three-Layer CE Listed Face Mask (50 Pack) - US $19.5 / AU $31.92 Delivered @JASGOOD
(Spam)
1320
WFH and learning something new daily during these time so here is collection of some useful good courses for everyone. All codes are already added. Stay Safe. Credit to FB Udemy Group and many other …
210
LPFREEDEL
La Porchetta offering free delivery since their dining rooms are closed due to lockdown :)
1960
We nearly lost our Aussie icon during the recent bushfire (remember that?). As reported - Lone Pine Koala Sanctuary near Brisbane, Queensland, currently has 15 livestreams running, eight of …
- 22
- Other
- Freebie
- 19 Sep 2023 3:20pm
551
Because f*ck Tissue hoarders. The Emerson Men's Cotton Handkerchiefs 13 Pack is ideal for keeping on hand throughout the day. Each handkerchief is woven from pure cotton for a soft and …
960
Two more freebies from Steam. School Years: https://store.steampowered.com/app/1125480/School_Years From the website: Simple Story: Alex: Hello, my friends! This is my first game. Why I make it on …
- 13
- Gaming
- Freebie
- 3 Apr 2020 10:14am
220
Ready to drink - just Twist 'N' Go.! Easy! An energy multivitamin with high dose B vitamins. With added vitamin C, calcium magnesium and zinc. Helps support mental sharpness and physical …
2620
An Apology to OzBargainer's Hi All, Here is a short video apology to all of the users effected and a thank you to those OzBargainers that supported me: https://vimeo.com/399035194 As promised …
270
Football Manager 2020 is now completely free to play on Steam until 3PM (GMT) on March 25th for PC/Mac Ideal for those of us 'working' from home at the moment
490
A great initiative to help support local business. Seems to be live in the app for me. They also aren't taking commission for any pick-up orders placed. Screenshot of …
110
YOUSAVE30
Click Bonanza at Big W. Listed price $239 and promocode will reduce another $30. Original code deal link Possible extra 5% off with discounted wish gift card.
1050
Most of these games are normally free, however they made some of their most popular paid games temporarily free. https://twitter.com/buttonshy/status/1238842938433683457?s=1...
1770
FREE22FREE33
Have spotted couple of awesome courses. Credit : Freebies Global Machine Learning Masterclass 3 Course in 1 FREE22 ( 80 Hours HD Rating: 4.3 out of 5 , 12,563 students ) Ethical Hacking …
1090
One year ago, we posted a deal here on Ozbargain which really helped kick start our restaurant. Off the back of the Ozbargain communities support, we have served over 25,000 patrons with endless …
350
$100 Adrenaline, Baby or Home Gift Cards Earn 2000 Woolworths Rewards (Worth $10) Bonus Points on these Gift Cards. Participating Retailers The Baby Card Adairs Kids, Baby Bunting, …
This deal is not published.
130
XE7UBHDK
1.Wavlink USB-C to USB-C Cable, Fast Charging & Data Transfer Cable $4.89 use code : XE7UBHDK https://www.amazon.com.au/dp/B07FL1S2C7?ref=myi_title_dp 【USB-C-C Cable】: Delivers data transfer …
920
Associated[Deactivated] @ Repo Guys Australia on 21/02/2020 - 13:21
ebay.com.au
PRESTO
Original Coupon Deal Nokia Withings Activite Steel Activity Sleep Track Watch 36mm Black HWA01 Black 44% OFF. DEAL IS ON NOW..!
80
Our Straws come in Standard size 20 cm and Cocktail short size 13 cm -The special is for the Standard Size Please contact us after purchase to claim your FREE BASIC COCKTAIL BOOK by Barprints 🌾 …
3250
This great deal is back again for a limited time. Enjoy :) PDF Conversion Tool allows you to easily and quickly convert almost any file into PDF format and back. It also provides the ability to …
This deal is not published.
Buy Pod Cot for Your Little Munchkin $2,299 + $175 Delivery @ Ubabub (Account Issue)
This deal is not published.
[VIC] Free Pearl Milk Tea, Today (18/2) 12pm-4pm @ Tealive (Melbourne)
(Duplicate)
590
Posting first deal … Noticed this is on discount after a long time. NIVEA MEN Power Fresh Shower Gel, 500ml Moisturising body wash for men 3 in 1 Shower Gel suitable for Face, Body & …
170
Seems to be 50% off. Not sure about the taste but would be suitable for people who likes their coffee dark roasted.
![[PC] Free - $15 off Coupon (Min $22.99 Spend) | Grand Theft Auto V Premium Edition (Expired) @ Epic Games](https://files.ozbargain.com.au/n/16/537516.jpg?h=80034580)
![[eBook] $0 Cookbooks - Indian, Vietnamese, Japanese @ Amazon AU/US](https://files.ozbargain.com.au/n/33/537433.jpg?h=46798e5d)
![[eBook] Free: Bacon Cookbook - 150 Easy Bacon Recipes $0 @ Amazon](https://files.ozbargain.com.au/n/72/537272.jpg?h=5c63502d)
![[PC] Free - 10 Second Ninja X (Was $14.50) @ Steam](https://files.ozbargain.com.au/n/23/537023.jpg?h=6bcff3dc)
![[PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle](https://files.ozbargain.com.au/n/43/536243.jpg?h=17333e99)
![[PC] 3 Free DLCs for Cities Skylines @ Steam](https://files.ozbargain.com.au/n/45/532545.jpg?h=4007b79f)
![[TAS] Free Indian Takeaway Meals for Needy/Elderly/Jobless @ Bombay on the Beach, Blackmans Bay (also Sikh Temple Hobart see OP)](https://files.ozbargain.com.au/n/09/531309.jpg?h=e5761124)
![[Kindle] 173 Free Childrens and Fiction eBooks @ Amazon AU](https://files.ozbargain.com.au/n/65/528065.jpg?h=95111e22)
![[QLD] Free Takeaway Food for Jobless @ Roshni Indian Restaurant Mackay](https://files.ozbargain.com.au/n/28/527528.jpg?h=b78f7bca)
![[PS4, XB1] The Division 2 $3, SW: Jedi Fallen Order $39 C&C (Or + Delivery), Devil May Cry 5 $8 (In-Store) @ Harvey Norman](https://files.ozbargain.com.au/n/42/527342.jpg?h=1dfc5e47)
![[VIC, QLD] Free Delivery with $20 Min Spend @ La Porchetta](https://files.ozbargain.com.au/n/30/526630.jpg?h=fedf8065)
![[PC] Steam - Free - Simple Story: Alex (free now) and School Years 初恋日记 (free from 2 April 4am - 3 April 6am) - Steam](https://files.ozbargain.com.au/n/03/526403.jpg?h=216ca431)
![[PC, Steam] Football Manager 2020 Free Play until 25th March](https://files.ozbargain.com.au/n/78/525378.jpg?h=ada831b6)
![[NSW, VIC] Free Delivery @ DoorDash](https://files.ozbargain.com.au/n/11/525311.jpg?h=a5d204f9)
![[VIC] Customer Appreciation Special - $14.90 (Lunch/Dinner) @ Miss Korea Kitchen 288 (Nunawading)](https://files.ozbargain.com.au/n/79/523679.jpg?h=60d5476c)
![[Win10] PDF Conversion Tool $0 (Quick & Efficient PDF Converter, Was $14.95) @ Microsoft Store](https://files.ozbargain.com.au/n/51/519851.jpg?h=21fb0bc1)
