SHiNiGaMi » deal and competition votes

1800
$10 Popcorn Chicken Bucket @ KFC

expired $10 Popcorn Chicken Bucket @ KFC

I received an email (like many of you, but thought it'd be good to share) about early access via the KFC App for $10 Popcorn Chicken Bucket. I haven't had it before, however previous …

121
[Android] Game Food Cutter 3D  Free (Was $2.09) @ Google Play

expired [Android] Game Food Cutter 3D Free (Was $2.09) @ Google Play

About the game. Freebie. Can't say much about it but 5 star reviewed, over 10k downloads and normally $2.09 Play in flight mode to say bye bye to Ads. Colorful relaxing cutting 3D game with …

30
[PC] Steam - The Surge 1 & 2 Dual Pack - $28.59 AUD - Steam

expired [PC] Steam - The Surge 1 & 2 Dual Pack - $28.59 AUD - Steam

Great price for this double pack. If you own already one of them the price will be reduced accordingly. From the website: This bundle includes The Surge and The Surge 2’s base game …

830
Free - 181 Page Digital Edition of Golf Australia Magazine - Tips to Improve Your Game (Available May 19)

expired Free - 181 Page Digital Edition of Golf Australia Magazine - Tips to Improve Your Game (Available May 19)

Stay safe, and enjoy :) During these unprecedented times one constant has remained. The desire of golfers to improve their game, whether able to play or not. To assist in this endeavour in a …

910
Coles ½ Price: Tyrrells Crisps 165g $2.25, Morning Star Grillers Vegan Mince 340g $4, Smash Glass Barista Buddy 340mL $6 + More

expired Coles ½ Price: Tyrrells Crisps 165g $2.25, Morning Star Grillers Vegan Mince 340g $4, Smash Glass Barista Buddy 340mL $6 + More

Coles half price specials, valid from Wed 13 May to Tue 19 May. Taken from the VIC metro catalogue. Bread & Bakery Was Now Save Discount Golden Crumpet Rounds 6 Pack $3.70 …

270
Choceur Chocolate Milk Sticks 200g $1.99 at ALDI

expired Choceur Chocolate Milk Sticks 200g $1.99 at ALDI

This is normally $2.69 and is newly on everyday low pricing. Didn’t see it in the catalogue. Spotted it in 2 stores in WA so assume nationwide. In reality this means it will be at this price most …

240
Moser Roth Dark 70% 125g $1.99, Choceur Salted Pretzel 200g $1.99, Beef Eye Fillet $19.99/kg, Knoppers 3pk/120g $1.99 @ ALDI

expired Moser Roth Dark 70% 125g $1.99, Choceur Salted Pretzel 200g $1.99, Beef Eye Fillet $19.99/kg, Knoppers 3pk/120g $1.99 @ ALDI

Just noticed some new Super Savers. Moser Roth Dark Chocolate, 70% Cocoa 5 x 25g $1.99 Choceur Salted Pretzel Chocolate Block 200g $1.99 Jindurra Station Beef Eye Fillet $19.99 per kg Brannans …

211
Pizza Hut Free Delivery (Min Spend $15) via Uber Eats

expired Pizza Hut Free Delivery (Min Spend $15) via Uber Eats

MYPIZZAHUT

Saw a banner in my Uber eats app with this promo code for free delivery for pizza hut with $15 spend. Can use for multiple orders too. Might be useful for someone

1830

expired [eBook, Kindle] $0 eBooks (Raspberry Pi, Excel, Python, Drawing, Hydroponic) @ Amazon AU/US

A selection of ebooks free at the time of posting. Please check carefully before purchasing! ebook US link AU link HYDROPONICS FOR BEGINNERS: The Complete Guide to Easily Build …

1010

expired [eBook] Free: "100 Healthy Vegan & Vegetarian Air Fryer Recipes" $0 @ Amazon

Even those who maintain healthy vegan and vegetarian lifestyles are not completely safe from the dangers of fried foods. Yes, vegetables contain less fat and cholesterol, but the oil, particularly …

610
Steggles Whole Roast Chicken $2.90 Per kg @ Woolworths

expired Steggles Whole Roast Chicken $2.90 Per kg @ Woolworths

Steggles Whole Roast Chicken $3 Per kg @ Woolworths (1.8 - 2.65 kg) weights will differ between States.

240
½ Price Cadbury Old Gold Block Varieties 180g $2.50 @ Woolworths

expired ½ Price Cadbury Old Gold Block Varieties 180g $2.50 @ Woolworths

Thanks for the TIP RichardL ! https://www.ozbargain.com.au/node/536902 Cadbury Old Gold Dark Chocolate Cherry Ripe Block 180g Cadbury Old Gold Dark Chocolate Old Jamaica Rum 'n' Raisin …

100

expired [PC] Steam - Sniper Elite: Nazi Zombie Army ~$3.55/Strange Brigade $11.04/Battlezone:Combat Commander $4.49 - Gamersgate

Some great prices on these games. Strange Brigade: https://www.gamersgate.com/DD-STRANGE-BRIGADE-REL/strange-br... Battlezone: Combat Commander: …

490
Free Kathmandu Summit Club until 8 June with Purchase (Worth $10)

expired Free Kathmandu Summit Club until 8 June with Purchase (Worth $10)

Was just browsing the store and found this. From the site: FREE Summit Club Membership from Thu 30 April to Mon 8 June 2020 Add to your shopping cart now, then resume shopping. Summit Club …

80
Quest Protein Bar Varieties $2, Quest Protein Cookies $2, Body Science Protein Bar Varieties $2 @ Woolworths

expired Quest Protein Bar Varieties $2, Quest Protein Cookies $2, Body Science Protein Bar Varieties $2 @ Woolworths

Woolworths has quest bars half price $2 each. I just grabbed a few.

50

expired [eBook] Free: "Hydroponics 101: A Complete Beginner's Guide" $0 @ Amazon (US Only)

When you download Hydroponics 101: A Complete Beginner’s Guide To Hydroponic Gardening, you will get an introduction to a variety of steps and strategies for starting a Hydroponic Gardening …

120
[Android] Free - BabyBook (was $0.99) - Google Play Store

expired [Android] Free - BabyBook (was $0.99) - Google Play Store

Appears to be a pretty useful app for new parents. From the website: Understand your new-born, keep the daily schedule under control A great newborn tracking app is an essential tool for new …

1970

expired [Kindle] Free eBook - Excel Bible for Beginners @ Amazon

Stay safe, and enjoy :) I wrote this book with the goal of teaching you everything you need to know about Microsoft Excel. The information in this book contains all the essential information you …

1690

expired [Kindle] Free - Easy Drawing Lessons for Ultimate Beginners: Start to Sketch @ Amazon AU/US

Amazon US link Welcome to the book all about Sketching and Drawing. Here is some good news right off the bat. This isn't just for the experienced and skilled artists who spend their days …

1340

expired [eBook] Free: "Reading between The Lines: Decoding Handwriting" $0 @ Amazon

If you have ever wondered what the squiggles and strokes in a line of ink say about personality, or if you are a handwriting professional who learned the "trait-stroke" method, Reading …

890
[Android] FREE - QR Barcode Scanner Pro/Truck Rush 3D/Bullet Agent/Infinity Dungeon/Haunted Hotel/and more - Google Play Store

expired [Android] FREE - QR Barcode Scanner Pro/Truck Rush 3D/Bullet Agent/Infinity Dungeon/Haunted Hotel/and more - Google Play Store

Free Android apps: QR/Barcode Scanner Pro (was $3.39): https://play.google.com/store/apps/details?id=com.barcode.qr... Oscilloscope Pro (was $1.09): …

1520
[Android, iOS] Free: "Guitar Pro" $0 @ Google Play & Apple App Store

expired [Android, iOS] Free: "Guitar Pro" $0 @ Google Play & Apple App Store

The Guitar Pro application allows all guitarists to enjoy viewing, playing, as well as writing tablature easily, right from their mobile device. This mobile version of the famous Guitar Pro …

2580
[PC] Free - Delores: A Thimbleweed Park Mini-Adventure @ Steam & Epic

Long Running [PC] Free - Delores: A Thimbleweed Park Mini-Adventure @ Steam & Epic

A freebie released today from the developers of Thimbleweed Park “as a thank you to our fans, we are releasing it for free as something you can have fun with in these odd times.“ Also available …

1520

expired [Kindle] Free - Python: Python Programming for Beginners Guide to Learn Python @ Amazon AU/US

Amazon US link. By reading this book you will gain an understanding of the basic concepts of Python Programming including: Variables Using Numbers in Python Using Strings in Python Logic …

1240

expired [eBook] $0 eBook: How to Draw Animals in Simple Steps @ Amazon

US AU By Donald Clark & Ryan Gray, 742 pages, published April 18, 2020 How To Draw Animals In Simple Steps: The Step By Step Guide To 200+ Animals Drawing For Beginners & Kids To Improve …

1690

expired [eBook] Free: "853 Hard to Believe Facts" $0 @ Amazon

This book is full of fun and verified facts, presented in an accessible manner that I hope will provide you with hours of entertainment. My objective has been to provide you with a lifetime supply …

350
[Android] Free: "Manual FX Camera" $0 @ Google Play

expired [Android] Free: "Manual FX Camera" $0 @ Google Play

FX Camera is designed to do one thing and one thing exceptionally well — to help you take truly amazing photos with manual camera controls. These precise controls are always within reach and …

730
Up to ½ Price Lindt Chocolates: Excellence Bars 100g $2.25 (was $4.5), Lindt Chocolate Balls 337g $10 (was $20) @ Woolworths

expired Up to ½ Price Lindt Chocolates: Excellence Bars 100g $2.25 (was $4.5), Lindt Chocolate Balls 337g $10 (was $20) @ Woolworths

Most of the Lindt Chocolates are 1/2 price at Woolies. Everyone can pick their favourites, I personally like the dark ones so got a few which goes well with Red Wine. Lindt Excellence Chocolate …

3070
Free Classical CD + Free Delivery @ Classics Direct (Normally $19.95, Choose 1 of 12)

out of stock Free Classical CD + Free Delivery @ Classics Direct (Normally $19.95, Choose 1 of 12)

Simply click link, scroll down, and add to cart - price drops to $0. No payment details required. Limited to one CD. Stay safe, and enjoy :)

150
[Steam] $0: Tennis World Tour DLC - Alex De Minaur, Caroline Garcia, Denis Shapovalov (Were $2.99 Each) @ Steam Store

expired [Steam] $0: Tennis World Tour DLC - Alex De Minaur, Caroline Garcia, Denis Shapovalov (Were $2.99 Each) @ Steam Store

Enjoy :) This content requires the base game Tennis World Tour on Steam in order to play. Free to keep when you get it before 2 Dec @ 5:00am. Some limitations apply. (?) Tennis World Tour - …

240
[Android] Free - Learn French with Mosa Lingua/Amazing Taxi Sim 2020 Pro/Super Hero Factory Inc Pro - Google Play Store

expired [Android] Free - Learn French with Mosa Lingua/Amazing Taxi Sim 2020 Pro/Super Hero Factory Inc Pro - Google Play Store

Some more freebies (1 educational app, 2 games) for your Android devices. Amazing Taxi Sim 2020 Pro: https://play.google.com/store/apps/details?id=com.Amazing.Ta... Super Hero Factory Inc Pro: …

330
Free - Foo Fighters: Skin and Bones (Live in Los Angeles 2006) @ YouTube

Long Running Free - Foo Fighters: Skin and Bones (Live in Los Angeles 2006) @ YouTube

Another free concert from the Foo Fighters. And it's available in 1080p! Foo Fighters Skin And Bones concert recorded at the Pantages Theater in Los Angeles in 2006. Keep washing your …

1330

expired [Kindle] $0 eBooks (Gardening, Travel Books, Excel, Python, Build a PC) @ Amazon AU/US

A selection of ebooks free at the time of posting. ebook US link AU link Raised Bed Vegetable Gardening Complete: Growing Fruit And Vegetables In Raised Bed Planters (Gardening …

970
Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

expired Free 440ml Magnum Tub + Free Delivery with Min $25 Spend @ Red Rooster Delivery & Red Rooster via Menulog/UberEats

This Mother’s Day weekend, treat mum and grab a FREE Magnum Tub on any delivery order from May 9th-10th. Offer is available in valid orders via orders.redrooster.com.au or the Red Rooster …

1600

expired [Kindle] $0 Takeout Cookbooks - Japanese, Thai, Lebanese, Chinese @ Amazon AU/US

Free at the time of posting. ebook US link AU link The Simple Art of Japanese Cooking: Everything You Need in a Japanese Cookbook US AU Japanese Takeout Cookbook …

4000
[PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

expired [PC, Steam] Free Ashes of the Singularity: Escalation at Humble Bundle

Free while supplies last or until 3am AEST on Monday the 11th of May. There is also a key redemption deadline of 3am AEST on Friday the 15th of May after you've claimed the game. As usual with …

790
3 Months (Usually 7 Days) Free Access to Calm Premium

expired 3 Months (Usually 7 Days) Free Access to Calm Premium

No credit card details required. Access will automatically expire at the end of three month period. Join the millions benefiting from the #1 Sleep & Meditation App Welcome to Calm! We …

470
[Android] 5 Free Pro Version Apps $0 - Sketch Me, Black Cam, Gif Me! Camera, Typit, Resize Me! @ Google Play

expired [Android] 5 Free Pro Version Apps $0 - Sketch Me, Black Cam, Gif Me! Camera, Typit, Resize Me! @ Google Play

Sketch Me Pro Turn your photos into drawing, cartoons or sketch images in one click to create instant works of art. Different effects easy to use with full control. Save your creations and …

1370
[Android, iOS] Free 'Peppa Pig Theme Park' (was $4.49) @ Google Play & Apple App Store

expired [Android, iOS] Free 'Peppa Pig Theme Park' (was $4.49) @ Google Play & Apple App Store

Been a very popular app in the past. Stay safe, and enjoy :) iOS link thanks dealbot

130
Small Sundae $1 @ McDonald's via mymacca's App

expired Small Sundae $1 @ McDonald's via mymacca's App

Get a Sundae for your Sunday, or any day this weekend. Not sure if targeted. Normally $3.60 or thereabouts.

70
Free Registration for 'Games for Change Virtual Festival 2020' @ Game for Change

expired Free Registration for 'Games for Change Virtual Festival 2020' @ Game for Change

G4C is excited to announce that the 17th annual Games For Change Festival will be virtual! For the first time, registration will be free to all participants – drawing a global audience to explore …

40
[PC] Steam - StarCrawlers $2.89/Sublevel Zero Redux $6.29/Obliteracers $4.30/Children of Zodiarcs $5.99 - Steam

expired [PC] Steam - StarCrawlers $2.89/Sublevel Zero Redux $6.29/Obliteracers $4.30/Children of Zodiarcs $5.99 - Steam

All time lowest prices for these games. StarCrawlers is a modern take on a classic cRPG dungeon crawler set in a gritty spacepunk universe. Build a crew of renegade adventurers on the fringes of …

80
Free - Virtual Interactive Guitar Tech Service @ Gibson

expired Free - Virtual Interactive Guitar Tech Service @ Gibson

Note - Zoom video conferencing software required. Source - Gibson the iconic, American-made instrument brand is proud to launch a FREE, virtual and fully interactive guitar tune-up service, the …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

1680

expired [Kindle] $0 eBooks (Japanese, Cookbooks, Java, Guitar, Parenting, Riddles, Spanish, Kids) @ Amazon AU/US

A selection of ebooks free at the time of posting. ebook US link AU link Top 30 Healthy, Popular, Delicious And Simple Japanese Appetizer, Main Dish And Salad Meals You Must Eat …

180
Free 600ml Soft Drink on Any Main Item Ordered Online or Takeaway in May (Must Show Voucher) @ Nando's

expired Free 600ml Soft Drink on Any Main Item Ordered Online or Takeaway in May (Must Show Voucher) @ Nando's

Grab a FREE 600ml soft drink on us the next time you order any main item online or to takeaway in May. Cheers to that!

1250

expired [eBook] Free: "Java For Beginners: A Simple Start To Java" $0 @ Amazon

Inside this life coaching guide you’ll learn exactly how to: Basic Syntax Objects and Classes Basic Data Types Variable Types Operators in Java Loops in Java Decision Making …

180
Bonus 1000/2000 Flybuys Points (Worth $5) for $50-$140 Spend @ Coles

expired Bonus 1000/2000 Flybuys Points (Worth $5) for $50-$140 Spend @ Coles

Received an email today for a new bonus points offer. Not the best deal but it all adds up, right Spend $50 in one shop at Coles! Activated coles offer. Collect 1,000 BONUS POINTS Spend $50 in …

780
[Android] FREE - Drum School (Expired) /SnoreGym/HEXASMASH/Message Quest/Fill Deluxe VIP/League Mon VIP - Google Play Store

expired [Android] FREE - Drum School (Expired) /SnoreGym/HEXASMASH/Message Quest/Fill Deluxe VIP/League Mon VIP - Google Play Store

Some more freebies (2 apps, 4 games) for your Android devices. SnoreGym: https://play.google.com/store/apps/details?id=com.snorelab.s... HEXASMASH: …

1360
[Android, iOS] Free - Tides of Time: The Board Game (Was $7.49) @ Google Play/Apple App Store

expired [Android, iOS] Free - Tides of Time: The Board Game (Was $7.49) @ Google Play/Apple App Store

Apple App store Tides of Time is a card drafting game for two players that takes place over three rounds. On your turn, choose one card from those in your hand, then pass your hand to your …