Bahngain » deal and competition votes

140
Urban Eats Dumplings/Gyoza 750g $7.99 @ ALDI

expired Urban Eats Dumplings/Gyoza 750g $7.99 @ ALDI

Super savers at Aldi have seen a price drop of $1 on the dumplings/gyozas.

1030
Lenovo ZA6F0017AU IdeaPad Duet 10.1" 2-in-1 Chromebook $424.15 + Shipping/Free C&C @ The Good Guys eBay

expired Lenovo ZA6F0017AU IdeaPad Duet 10.1" 2-in-1 Chromebook $424.15 + Shipping/Free C&C @ The Good Guys eBay

PGGUYS15

Some people like this chromebook. This seems like a good price. If you are interested in a chromebooks and timing is not critical it might be worth waiting for the Ryzen versions to go on …

90

out of stock Unisex Adult Ultra-Lite Waterproof Breathable Protective Rain Suit, XL Size $12.41 + Delivery ($0 with Prime) @ Amazon AU

Ultra-Lite2 Rain Suit includes a jacket and pant Made with Frogg Toggs breathable, non-woven fabric that is waterproof, wind-resistant, and lightweight Jacket features an adjustable hood with cord …

1120
[Android] Free: Watch Face - Pujie Black (for Wear OS & Galaxy Watch, Was $2.97) @ Google Play

expired [Android] Free: Watch Face - Pujie Black (for Wear OS & Galaxy Watch, Was $2.97) @ Google Play

Decent app for Wear OS and Galaxy watch owners who love to customise watch faces.

660

expired [Switch] Animal Crossing: New Horizons $61.40 Delivered @ Amazon AU

All-time best price for this game according to Deku Deals. Good for those who have missed out on other discounts available from Amazon. Over $39 so delivery is included. If eligible, the discount …

150
40% off Sitewide + Free Shipping @ Kipling

expired 40% off Sitewide + Free Shipping @ Kipling

Great quality bags, super stylish as well! Website says able to stack with 10% off signup bonus. Free shipping as well. Could not find end date for sale.

50
Receive $10 or $20 in Bitcoin When You Create a New Account and Convert $250 in Bitcoin, Eth or LTC @ RoundTheBlock

expired Receive $10 or $20 in Bitcoin When You Create a New Account and Convert $250 in Bitcoin, Eth or LTC @ RoundTheBlock

Receive $10 or $20 in Bitcoin when you create a new account with Round The Block and convert $100AUD or more in any accepted cryptocurrency to Pay a Bill using Bpay, Send to an Australian Bank …

1250
$5 Referral on Spaceship Voyager ($5 Minimum Deposit) (until Oct 30 2020)

expired $5 Referral on Spaceship Voyager ($5 Minimum Deposit) (until Oct 30 2020)

Spaceship Voyager referral bonus for $5. Previous post https://www.ozbargain.com.au/node/556126 expired therefore this post was made. The $5 referral codes are valid up to 30 days until the …

290
Belong $40 Starter Pack for $20 @ Woolworths

expired Belong $40 Starter Pack for $20 @ Woolworths

Not listed on current catalogue but actually available in stores along $25 kit offer (which is $10/pack) which are on sales [some stores not updated to sales price yet], then will be officially on …

1980
[XB1, PC] EA Play Membership Included with Xbox Game Pass @ Microsoft

Long Running [XB1, PC] EA Play Membership Included with Xbox Game Pass @ Microsoft

EA play will be part of Game Pass from November 10. Earlier this month we announced that we’ve teamed up with Electronic Arts to provide Xbox Game Pass Ultimate and PC members an EA Play …

120

expired The Baby-Sitters Club Colour Graphix 1-4 Box Set $20 @ Big W

Daughter wanted these for Christmas so I was on the lookout for them. The 1-4 box set is $37 at Amazon and other places so $20 is a great price.

50
[SA] Free Beam Scooter Rides 5-11PM

expired [SA] Free Beam Scooter Rides 5-11PM

Beam are extending the footy fun at Adelaide Oval with free rides today between 5-11pm. Whether you're making a dash for the first bounce or venturing out for a post-match bite, nothing is out …

2770
[PC] Free - Pikuniku @ Epic Games

expired [PC] Free - Pikuniku @ Epic Games

Upcoming freebies from Epic games. As usual, available from 1am. Evidence Credit to Dealabs P.S. there is a high likelihood there will be another Ubisoft freebie for this week! (looks like the …

80
[VIC] 12x Handee Ultra Paper Towels $8.95, 40x Sorbent Double Length Toilet Rolls $31.95 @ Wallies Lollies (Box Hill South)

expired [VIC] 12x Handee Ultra Paper Towels $8.95, 40x Sorbent Double Length Toilet Rolls $31.95 @ Wallies Lollies (Box Hill South)

Local shop that's been supporting the community through the crisis, and I want to share some of the support back. If you live within 5km of the store (VIC Box Hill), you can get deals on: - …

1590
[NSW, ACT, VIC, TAS] Slow Cooked Pork Knuckle $7.50/kg @ Woolworths

expired [NSW, ACT, VIC, TAS] Slow Cooked Pork Knuckle $7.50/kg @ Woolworths

A great buy. Previous OzB low appears to be $8.99/kg at Aldi. Please stay safe, and enjoy :) Catalogue screenshot here.

250
3 Months of Xbox Game Pass for PC with Discord Nitro

expired 3 Months of Xbox Game Pass for PC with Discord Nitro

Enjoy :) Pls, Don't get confused with this deal - 3 Months Discord Nitro to report duplicate. Thanks to Krondorf for letting me know. More details We’re so happy to announce that …

1581
Bonus $20 Cashback with $20 Spent at Any* Stores (Excluding Woolworths GiftCards) @ Cashrewards

expired Bonus $20 Cashback with $20 Spent at Any* Stores (Excluding Woolworths GiftCards) @ Cashrewards

Hi Guys, Received this sweet email, definitely targeted. Terms and conditions This promotion is open only to members that receive an invitation email directly from Cashrewards. To be eligible for …

1840
367 Free Microsoft Azure Courses, Articles & Exams @ Pluralsight

expired 367 Free Microsoft Azure Courses, Articles & Exams @ Pluralsight

A further 127 courses have been added since dealbot's previous post. Simply register via any email address to access the full suite of courses. Please stay safe, and enjoy :) Pluralsight and …

880
Wei Lih Ichiban Noodle Bowl (Made in Taiwan): Roast Pork or Beef 150g / Spicy Sichuan Beef 140g - $2.60 (Was $4.40) @ Woolworths

expired Wei Lih Ichiban Noodle Bowl (Made in Taiwan): Roast Pork or Beef 150g / Spicy Sichuan Beef 140g - $2.60 (Was $4.40) @ Woolworths

Ichiban Noodle Bowl Roast Beef 150g $2.60 https://www.woolworths.com.au/shop/productdetails/841640/ich... Ichiban Noodle Bowl Roast Pork 150g …

2530
Fargo Seasons 1, 2 and 3 Streaming on SBS On Demand [Free]

expired Fargo Seasons 1, 2 and 3 Streaming on SBS On Demand [Free]

All 30 episodes available to stream now in HD. Season 4 starts on 8 October on SBS. The series has won a variety of Emmys and Golden Globes. Season Rotten Tomatoes Metacritic 1 97% …

1880
[Android, iOS] Free: "RIDBC Auslan Tutor" $0 @ Google Play & Apple App Store

expired [Android, iOS] Free: "RIDBC Auslan Tutor" $0 @ Google Play & Apple App Store

The RIDBC Auslan Tutor is a video-based Australian Sign Language teaching app. The RIDBC Auslan Tutor has been designed to assist families of young deaf children learn Auslan. More than 500 …

3441
Studio Ghibli Releases 400 Images from Eight Movies Free to Download Online

Long Running Studio Ghibli Releases 400 Images from Eight Movies Free to Download Online

From this month, Ghibli Studio will provide scene photos of all Studio Ghibli works in sequence. This month, Ghibli Studio will provide 8 works, mainly new works, for a total of 400 pieces. Feel …

170
[Switch] 50% Square Enix Titles: Lost Sphear $27.98 (60%), FFIX $15.97, FFVIII Remastered $14.97, FFVII $11.97 @ Nintendo eShop

expired [Switch] 50% Square Enix Titles: Lost Sphear $27.98 (60%), FFIX $15.97, FFVIII Remastered $14.97, FFVII $11.97 @ Nintendo eShop

Following Steam sale, most of Final Fantasy titles & some games published by Square Enix is having 50% off in eShop, with exception of Lost Sphear is 60% off. Titles listed below are all time …

6600
$2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

expired $2 Bonus with $50 Discounted Woolworths Gift Card Purchase @ Cashrewards (Activation Required, Stack with 5% Discount, OzB Only)

Hi everyone. Another nice bonus for our members which works out to a 9% saving on a $50 gift card, although the bonus does apply to any purchase of $50 or more. Please read the terms and activate …

1460

expired $20 Zip Credit on $50 or More Spend Using Zip Pay / Zip Money - Online or in-Store @ Big W

Saw this on Big W home page - Get $20 Zip credit on shopping of $50 or more and using Zip payment method. Expires 24-Sep. Couldn't find any more information on T&Cs. This is similar to …

1980
Free Cheesymite Scrolls @ Bakers Delight (No Purchase Required, One Per Customer, Excludes VIC)

expired Free Cheesymite Scrolls @ Bakers Delight (No Purchase Required, One Per Customer, Excludes VIC)

Available Tuesday Sept 29. Stay safe, and enjoy :) Bakers Delight is turning 40 and giving away 40,000 Cheesymite Scrolls to celebrate. There’s a limit of one scroll per customer, and strict …

570
Free Delivery (Tacos $3 Delivered) @ Guzman Y Gomez via Menulog (Stack with up to 15% Cashback ( $30 Cap) @ ShopBack)

expired Free Delivery (Tacos $3 Delivered) @ Guzman Y Gomez via Menulog (Stack with up to 15% Cashback ( $30 Cap) @ ShopBack)

Edit - 15% cashback (new Menulog customers) and 5% cashback (existing) capped at $30 via Shopback. Tacos are currently $3 for a limited time. Order through Menulog to get them delivered for …

420
Google Nest Hub Max $298 + $40 Store Credit @ The Good Guys / The Good Guys eBay

expired Google Nest Hub Max $298 + $40 Store Credit @ The Good Guys / The Good Guys eBay

Looks like the lowest price at the moment for the nest hub max. Looks like good guys are having a sale on both the nest hub products. Similar to the nest hub deal Also available in chalk $40 store …

70
[Switch] Book of Demons $19.97/ABZU $21/Last Day of June $15/Two Point Hospital $41.96 - Nintendo eShop

expired [Switch] Book of Demons $19.97/ABZU $21/Last Day of June $15/Two Point Hospital $41.96 - Nintendo eShop

Great prices for these games - either tge all time lowest price or matching it. Note: The sale for Book of Demons, ABZU and Last Day of June ends on 30 August 2020! ABZU: …

4120
Free: Phillip Island Penguin Parade - Live Daily Penguin TV Streaming (Daily at 6PM AEST) @ Penguins.org

expired Free: Phillip Island Penguin Parade - Live Daily Penguin TV Streaming (Daily at 6PM AEST) @ Penguins.org

From Tuesday, 25 August 2020, 6:00PM (AEST), you can indulge in some nature from the comfort of your own living room. Phillip Island’s much-loved penguin parade is being live streamed …

240
$10 Cashback after Spending $10 at Bundll (New Accounts)

expired $10 Cashback after Spending $10 at Bundll (New Accounts)

For those unfamiliar, a digital Google/Apple Pay Card that lets you pay on it, and they'll give you 2 weeks credit interest free (automatically bundled with your other purchases on the card and …

150
Free 700+ Hospitality Lessons until 30th September 2020 (Was A$9.17 Per Month, $109.99 Annually for Individuals) @ Typsy

expired Free 700+ Hospitality Lessons until 30th September 2020 (Was A$9.17 Per Month, $109.99 Annually for Individuals) @ Typsy

COVID19

No charge for 700+ hospitality lessons until 30th September 2020. The Typsy library now includes vital lessons that can be used to support the learning requirements in the COVID-19 containment and …

620
½ Price Sunrice Jasmine Fragrant Rice 5kg $10, Twinings Tea Bags Pk 80-100 $5.50 @ Woolworths

expired ½ Price Sunrice Jasmine Fragrant Rice 5kg $10, Twinings Tea Bags Pk 80-100 $5.50 @ Woolworths

Sunrice Jasmine Fragrant Rice 5kg - $10 Long, slender, fragrant grains define this classic rice variety. When cooked, the grains display a delicate fragrance. Jasmine is the preferred rice in …

960
Free - JOKER: Put on a Happy Face Documentary by Warner Bros @ iTunes

expired Free - JOKER: Put on a Happy Face Documentary by Warner Bros @ iTunes

Newly released documentary. Grab it while it’s free! Featuring interviews with filmmakers and industry legends, discover the origins and evolution of The Joker, and learn why The Clown Prince …

830
[SA] All You Can Eat Schnitzel $9.90 (Thursday Nights) @ Cudlee Creek Restaurant Tavern

expired [SA] All You Can Eat Schnitzel $9.90 (Thursday Nights) @ Cudlee Creek Restaurant Tavern

Thursday Nights 6pm to 8pm Chicken, pork and beef available. Kids under 10 is $8 +$2 for gravies and sauces +$4 for parmigiana Bookings essential 8389 2319

1030
1/2 Price - SunRice Jasmine Rice 5kg $10, Carman's Muesli Bars 160g-270g $3 @ Coles

expired 1/2 Price - SunRice Jasmine Rice 5kg $10, Carman's Muesli Bars 160g-270g $3 @ Coles

From the upcoming catalogue sale starting on Wednesday 15 July.

100
[Android] This Is The Police $2.99 (Was $11.99) @ Google Play

expired [Android] This Is The Police $2.99 (Was $11.99) @ Google Play

This Is the Police is a strategy/adventure game set in a city spiraling the drain. Taking the role of gritty Police Chief Jack Boyd, you'll dive into a deep story of crime and intrigue. Will …

1002
Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

expired Guzman Y Gomez (Expired) | McDonald's (Fri-Sun, Min Spend $25) - Free Delivery via Uber Eats

GYGDELIVERYGYGFREEDELMACCASWIN

Source - Yes, you’ve got that right, Free Delivery is back with our pals over at Uber Eats and this time there is no limit to the amount of times you can get Free Delivery with no minimum spend …

820
[Android] Chrono Trigger $7.99, Dragon Quest (1-6+8) and Final Fantasy (1-8) Sale - Google Play Store

expired [Android] Chrono Trigger $7.99, Dragon Quest (1-6+8) and Final Fantasy (1-8) Sale - Google Play Store

A Square Enix sale for Android devices. The following games are on sale: Final Fantasy - $5.99 Final Fantasy II - $5.99 Final Fantasy III - $10.99 Final Fantasy IV - $10.99 Final Fantasy IV: The …

100
Free Online Masterclass on Portrait Painting, 28/4-12/5 @ National Portrait Gallery (NPG) Canberra

expired Free Online Masterclass on Portrait Painting, 28/4-12/5 @ National Portrait Gallery (NPG) Canberra

If you’re tired of only seeing your face in self-isolation, now might be the perfect time to get into portrait painting. And the National Portrait Gallery (NPG) in Canberra can help with that – …

110
$100 off Orders over $155 at Naked Wines

expired $100 off Orders over $155 at Naked Wines

JNW15PJ3

In case that the provided URL does not fill these automatically: Code: PHOTO19 Password: JNW15PJ3 The have a good mixed bundle of 12 wines (white, red, rose) which it brings it down to only $6.67 a …

990
3-Month Pause of Repayments and Interest for Westpac, St George, Bank SA, Bank of Melbourne Credit Cards Impacted by COVID-19

expired 3-Month Pause of Repayments and Interest for Westpac, St George, Bank SA, Bank of Melbourne Credit Cards Impacted by COVID-19

Ok I know what you're thinking - why is this a deal? It's a great deal for those whom have westpac cards and are impacted by job loss or loss of income as you are effectively getting …

12518
[SUBS] Disney Pixar Animated Film: "Onward" Available on Disney Plus (Subscription Required)

expired [SUBS] Disney Pixar Animated Film: "Onward" Available on Disney Plus (Subscription Required)

$6.99 to rent on all other services (as it's a new release). Disney's "Onward" Movie Free on Disney+. Yes I know it's a subscription service but obtain a free trial. I …

1861
Free - Full Series of Sailor Moon/Sailor Moon R/Sailor Moon S (From 24/4, VPN Required) | Rebuild of Evangelion Movies @ YouTube

expired Free - Full Series of Sailor Moon/Sailor Moon R/Sailor Moon S (From 24/4, VPN Required) | Rebuild of Evangelion Movies @ YouTube

As reported - The official website for the two-part film Pretty Guardian Sailor Moon Eternal The Movie announced today that the first three original Sailor Moon TV anime series in the 1990s will …

800
National Space Centre to Stream Free Planetarium Show via YouTube "We Are Stars"

expired National Space Centre to Stream Free Planetarium Show via YouTube "We Are Stars"

The National Space Centre is giving families the chance to enjoy a film night with a difference. The Leicester attraction will be streaming a planetarium show online for the first time ever, …

120
[NSW] 6-Star Scotch Fillet Roll $19/kg, 5-Star Eye Fillet Roll $14/kg + Del/Free 3+ Cartons (Business Name Required) @MeatOnline

expired [NSW] 6-Star Scotch Fillet Roll $19/kg, 5-Star Eye Fillet Roll $14/kg + Del/Free 3+ Cartons (Business Name Required) @MeatOnline

NOTE! This is for PRO LEVEL bargain hunters Fairly large minimum orders, 1 carton is about 15-18kgs. Shipping is $40 or free for metro orders over 3 cartons. So you'll need to group buy with …

230
Spotify Premium - 2 Months Free Trial (New Users Only)

expired Spotify Premium - 2 Months Free Trial (New Users Only)

As a secondary option, this below link is the direct checkout link that I used. https://www.spotify.com/au/purchase/offer/crusader-60d/ You can change to a free account immediately as soon as the …

1820

expired Virgin Australia Resuming Domestic Flights (Limited Schedule) from 17 April to June 7th, One Way Fares from $95

The limited domestic schedule will include as many as seven flights a week each way between Australia’s major capital cities. Regional airports including Rockhampton and Mackay will also be …

2970
Senso,Sebego,Reebok,Dr Martens From $19.99 Adidas 4D $130 Ultraboost/Nike/ONITSUK/Lacoste $49.99 + Shipping @ Hype DC

expired Senso,Sebego,Reebok,Dr Martens From $19.99 Adidas 4D $130 Ultraboost/Nike/ONITSUK/Lacoste $49.99 + Shipping @ Hype DC

Morning: The Early Bird Catches The Worm. Great choice from Hype DC while stocks last. ADIDAS PERFORMANCE ALPHAEDGE 4D $129.99 …

This deal is not published.
[Android] Stardew Valley $7.49 (Was $12.99) @ Google Play Store (Duplicate)